SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 400668.Mmwyl1_4253 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400668.Mmwyl1_4253
Domain Number 1 Region: 16-130
Classification Level Classification E-value
Superfamily Translational machinery components 2.68e-47
Family Ribosomal protein L18 and S11 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 400668.Mmwyl1_4253
Sequence length 130
Comment (Marinomonas MWYL1)
Sequence
MAKPATRNTKKKVKKTVVDGVAHVHASFNNTIVTITDRQGNALSWATAGGSGFRGSRKST
PFAAQVAAERAGTVAQEFGLKNVDVMIKGPGPGRESAVRALNALGLRINNITDVTPIPHN
GCRPPKKRRV
Download sequence
Identical sequences A0A1A8TU98 A0A1M5L6U0 A6W369 W1RW11
gi|152998248|ref|YP_001343083.1| 400668.Mmwyl1_4253 WP_012071913.1.21196 WP_012071913.1.22010 WP_012071913.1.45605 WP_012071913.1.75617 WP_012071913.1.83784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]