SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 401473.BDP_0367 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  401473.BDP_0367
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-45
Family Ribonuclease PH domain 1-like 0.000000692
Further Details:      
 
Domain Number 2 Region: 327-499
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-42
Family Ribonuclease PH domain 1-like 0.00000122
Further Details:      
 
Domain Number 3 Region: 153-262
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.72e-25
Family Ribonuclease PH domain 2-like 0.0000217
Further Details:      
 
Domain Number 4 Region: 481-579
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.42e-23
Family Ribonuclease PH domain 2-like 0.0000298
Further Details:      
 
Domain Number 5 Region: 589-676
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.18e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 6 Region: 266-352
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.66e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 7 Region: 652-732
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000136
Family Cold shock DNA-binding domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 401473.BDP_0367
Sequence length 880
Comment (Bifidobacterium dentium Bd1)
Sequence
MEGPEIKAVEAVIDNGSFGKRTLRFETGRLAQQADGAVAAYLDDDSMILSTTTAGSSPKE
NYDFFPLTVDVEEKMYAAGKIPGSFFRREGRPSSEAILACRIIDRPLRPLFPHTLRNEVQ
VVETVLAVNPDDAYDVIALNAASASTMISGLPFEGPVSGVRLALIDGQWVAFPRWSERER
AVFEIVVAGRVVENGDVAIAMIEAGAGKNAWHLIYDEGQTKPDEEVVAGGLEAAKPFIKV
ICEAQAELKKIAAKETKEFQLFPEYTEDLYNRIDEIAHADLDEALSIAEKLPRQDRIHEI
KEGVKATLAEEFTDMDDAEKDKEIGNAFKELQRQIVRRRILTQDYRIDGRGLRDIRTLSA
EVDIVPRVHGSALFQRGETQILGVSTLNMLKMEQQIDALSGPQSKRYMHNYEMPPYSTGE
TGRVGSPKRREIGHGALAEKALVPVLPSREEFPYAIRQVSEAIGSNGSTSMGSVCASTLS
LLAAGVPLKAPVAGIAMGLVSGDVDGQHIFKTLTDILGAEDAFGDMDFKVAGTSEFITAL
QLDTKLDGIPADILASALQQAKEARTTILEVINECIDGPAEMSPFAPRIITTTVPVDKIG
EVIGPKGKMINQIQEETGAEIAIEDDGTVFISSEGGEGAEKAKEIIDSIANPHVPESGET
YNGKVVKTTSFGAFVNLTPGTDGLLHISQIRNLANGERIDAVEDVLKEGDTVEVIVQGVD
DRGKISLAIPGFEDQESSAPRREHGDRSDRDDRRGGRGRRDDRRSDRDDRDYDDRPRRRR
SDRDDRDYDDRPRRRRERDYDDRDDRDYDDRPRRRRSDRDDRDYDRDDRRSDRRGGRGRR
DDRNPRYAADENYDEYRADREERSERPRRRIRRDFDPFED
Download sequence
Identical sequences A0A1V8Q5U7 D2Q8A8
gi|283455304|ref|YP_003359868.1| 401473.BDP_0367 WP_012901865.1.100840 WP_012901865.1.14814 WP_012901865.1.2424 WP_012901865.1.39260 WP_012901865.1.91619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]