SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 401473.BDP_2179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  401473.BDP_2179
Domain Number 1 Region: 158-214
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.00000000000000144
Family Head domain of nucleotide exchange factor GrpE 0.0038
Further Details:      
 
Domain Number 2 Region: 74-157
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.00000000000000745
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 401473.BDP_2179
Sequence length 216
Comment (Bifidobacterium dentium Bd1)
Sequence
MSDFNKDEYLNDLPDMDNLSGQTAPSGTGPAADDAAAGAPESAAADTAADSAQAEGSATA
ANAEDAAADDTLTPLGQAKKEAAEYLEALQRERAEFINFRNRAQKEQDRFRQHGIIDVLT
ALLPALDDIDRIREHSEMDDSFKAVSAKIDKAFEKFGVEKFGEKGEDFDPTKHDAILHKP
DPTAEKETVDTVVEAGYRIGDRVIRAARVVVASPQG
Download sequence
Identical sequences D2Q7H4
WP_003838238.1.11892 WP_003838238.1.14814 WP_003838238.1.2424 WP_003838238.1.39260 WP_003838238.1.42327 WP_003838238.1.91619 401473.BDP_2179 gi|283456996|ref|YP_003361560.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]