SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 402612.FP1146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402612.FP1146
Domain Number 1 Region: 311-470
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.73e-28
Family HD domain 0.025
Further Details:      
 
Domain Number 2 Region: 208-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000918
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 402612.FP1146
Sequence length 520
Comment (Flavobacterium psychrophilum JIP02 86)
Sequence
MDIITIIIAVIAGIGGGFGISKFLEKSGVSNLIKNAKKEASSILKDANLEGENIKKDKIL
QAKEKFIELKSEHEQVILTRDRKVAEVEKRVRDKESQVSGELSKAKKINDDFEAKTNEYN
TKLENLEKKQVEVEKMHKSQLQQLEVISGLSTEEAKNQLIEGLKSEAKTQAMAHIQETIE
EAKLTAQQEAKKIIISTIQRVGTEEAVENCVSVFNIESDDVKGRIIGREGRNIRAIEAAT
GVEIIVDDTPEAIILSCFDPVRREIARLALHKLVTDGRIHPARIEEVVAKTTKQIDDEII
EVGKRTVIDLGIHGLHPELIKVVGRMKYRSSYGQNLLQHSREVSKLCGIMAAELGLNVKL
AKRAGLLHDIGKVPDAESDLPHALLGMQWAEKYGEKEEVCNAIGAHHDEIEMKSLLSPIV
QVCDAISGARPGARRQVLDSYIQRLKDLEEVAYGFNGVKSAYAIQAGRELRVIVESEKVS
DDNASNLSFEISQKIQTEMTYPGQVKVTVIRETRAVNIAK
Download sequence
Identical sequences A0A075RHM8 A6GYR0
gi|150025218|ref|YP_001296044.1| WP_011963284.1.100426 WP_011963284.1.101623 WP_011963284.1.10377 WP_011963284.1.10561 WP_011963284.1.12512 WP_011963284.1.12753 WP_011963284.1.15571 WP_011963284.1.15665 WP_011963284.1.16958 WP_011963284.1.22253 WP_011963284.1.27336 WP_011963284.1.27491 WP_011963284.1.2967 WP_011963284.1.30756 WP_011963284.1.30825 WP_011963284.1.31486 WP_011963284.1.32945 WP_011963284.1.33550 WP_011963284.1.3641 WP_011963284.1.40553 WP_011963284.1.40914 WP_011963284.1.43917 WP_011963284.1.45424 WP_011963284.1.5002 WP_011963284.1.50272 WP_011963284.1.50511 WP_011963284.1.50736 WP_011963284.1.53635 WP_011963284.1.54396 WP_011963284.1.54855 WP_011963284.1.576 WP_011963284.1.58126 WP_011963284.1.61602 WP_011963284.1.68368 WP_011963284.1.68717 WP_011963284.1.68719 WP_011963284.1.73469 WP_011963284.1.74858 WP_011963284.1.75146 WP_011963284.1.76480 WP_011963284.1.76736 WP_011963284.1.7721 WP_011963284.1.80382 WP_011963284.1.8311 WP_011963284.1.8427 WP_011963284.1.85466 WP_011963284.1.87512 WP_011963284.1.87756 WP_011963284.1.90531 WP_011963284.1.91006 WP_011963284.1.94014 WP_011963284.1.94582 WP_011963284.1.94751 WP_011963284.1.94875 WP_011963284.1.97969 YP_001296044.1.27502 402612.FP1146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]