SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 402880.MmarC5_0274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402880.MmarC5_0274
Domain Number 1 Region: 10-149
Classification Level Classification E-value
Superfamily S13-like H2TH domain 5.89e-28
Family Ribosomal protein S13 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 402880.MmarC5_0274
Sequence length 149
Comment (Methanococcus maripaludis C5)
Sequence
MTQTEFKHRIRISKTDLEGKNPLEYALQEMKGIGRAMARAVIRVTELDPKQQAGYLADED
VLKIESVLEDPATHGIPSWMFNRKKDVYSGLDKHLIETDLVLTVQEDITNMKKIRCYKGV
RHELRLPCRGQRTRGSFRKGTSMGVKRRK
Download sequence
Identical sequences A4FWL5
WP_011868045.1.72418 402880.MmarC5_0274 gi|134045319|ref|YP_001096805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]