SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 402881.Plav_2758 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  402881.Plav_2758
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.28e-49
Family Ribosomal protein S13 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 402881.Plav_2758
Sequence length 122
Comment (Parvibaculum lavamentivorans DS-1)
Sequence
MARIAGVNIPTNKRVVIALTYIHGIGNTKAKEICGTVGIPAERRVNELTDAEVIQIREAI
DRDYLVEGDLRREVSMNIKRLMDLGCYRGLRHRKGLPVRGQRTHTNARTRKGPAKAIAGK
KK
Download sequence
Identical sequences A7HWT3
gi|154253199|ref|YP_001414023.1| 402881.Plav_2758 WP_012111680.1.7923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]