SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 403833.Pmob_0083 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  403833.Pmob_0083
Domain Number 1 Region: 310-468
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.17e-31
Family HD domain 0.016
Further Details:      
 
Domain Number 2 Region: 205-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.8e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 403833.Pmob_0083
Sequence length 517
Comment (Petrotoga mobilis SJ95)
Sequence
MEILVYIIIGIAIFILSLLVGINIGNRRMISTLATKKEELEVEIKNKQKEIEKMLKNAEE
EAKALKQKELLEAKEEIHRLRQEFDSEAKQQREELKANEERLIRKEESLAKKEENLEKLK
EKLEVQHENVLKLEKELETKLNEIAKMTEEEARQVVINEARDKYEREIAQKFKEIKDHYE
EESKKYARWVITTAIQRYASDVTNEITTSTVALPTDDMKGRIIGREGRNIRTFEKLTGTD
LIIDDTPEIVVISSFNPLRREIAKRTLEMLVADGRIHPARIEELYEKSKNEIQEYIKEVG
KEAVMRVGIKQPHLEIIKLLGRLKFRTSYGQDVLEHSIEVAQFAGMMASELGLNVELAKR
AALLHDLGKAVDHEVEGSHAIVGGQIAKRYGEKLEVVNAIQYHHNEVDPMTPEAVLVAAS
DALSASRPGARKETLENYIRRIEQLEEIAKSFRYVDKAYAIQAGRELRIIVQPDKVEDEI
AEKLAHDISVQIEEKVQYPGVIKVTVIREKRSISYAS
Download sequence
Identical sequences A9BEV4
gi|160901574|ref|YP_001567155.1| 403833.Pmob_0083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]