SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 404589.Anae109_3127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404589.Anae109_3127
Domain Number 1 Region: 7-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 404589.Anae109_3127
Sequence length 109
Comment (Anaeromyxobacter Fw109-5)
Sequence
MLHLRLEHRNGALVVTPLAARLDAESAVELRTLIAGQAVGRRRVVVSLEHVATMDGSALA
ALISILKSMDPGAELRLARASPSVRALLARTRLDALFPTFDDEAAALGG
Download sequence
Identical sequences A7HF27
WP_012097940.1.20576 404589.Anae109_3127 gi|153005982|ref|YP_001380307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]