SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405416.ACICU_03226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405416.ACICU_03226
Domain Number 1 Region: 119-295
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.89e-41
Family Nitrogenase iron protein-like 0.066
Further Details:      
 
Domain Number 2 Region: 13-71
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405416.ACICU_03226
Sequence length 362
Comment (Acinetobacter baumannii ACICU)
Sequence
MTAAIRRTVTFPEISMERLKSILGAYNGHLKQIEQRLDVKITHRGDVFYIDGEIDAVGRA
EALLQRLYEETEASQQISADLLHLLIQSSQTERNFELVGEEMDEHDAPMDVYFQTRKGRI
NPRGANQKRYVQRILQSDISFGVGPAGTGKTYLAVAAAVDMLERNEIQRILLVRPAVEAG
EKLGFLPGDLTQKIDPYLRPLYDALYEMLGFEKVAKLIERQVIEVAPLAYMRGRTLNHSF
VILDEAQNTTPEQMKMFLTRLGFGSRAVITGDITQVDLPRGQQSGLAHALRVLENIKEIH
ITRFHSRDVVRHQLVQKIVEAYEGWDGEQQRLNAEARAERKARQEALIAENDTAADLQHQ
DA
Download sequence
Identical sequences A0A009FXE6 A0A009HMC6 A0A009KID7 A0A009P9C8 A0A009SQZ4 A0A062EUN7 A0A062FK34 A0A062I7Z9 A0A062IRT9 A0A062MHL5 A0A0J1A400 A0A0R1C028 A0A158LY10 A0A171F095 A0A1C4HMJ6 B0V6R3 D0CD49 G2JDN0 L9P7W4 N9GU50 N9JNE4 N9LFA1 S3TNR3 V5V9M7
gi|387122537|ref|YP_006288419.1| gi|469823088|ref|YP_007597458.1| WP_000122983.1.100006 WP_000122983.1.100121 WP_000122983.1.100124 WP_000122983.1.100136 WP_000122983.1.100152 WP_000122983.1.100157 WP_000122983.1.100222 WP_000122983.1.100225 WP_000122983.1.100238 WP_000122983.1.100259 WP_000122983.1.100290 WP_000122983.1.1003 WP_000122983.1.100380 WP_000122983.1.100406 WP_000122983.1.100454 WP_000122983.1.100567 WP_000122983.1.100568 WP_000122983.1.10058 WP_000122983.1.100656 WP_000122983.1.100864 WP_000122983.1.100957 WP_000122983.1.101001 WP_000122983.1.101005 WP_000122983.1.101012 WP_000122983.1.101037 WP_000122983.1.101069 WP_000122983.1.101100 WP_000122983.1.101254 WP_000122983.1.101258 WP_000122983.1.101276 WP_000122983.1.101338 WP_000122983.1.10136 WP_000122983.1.101389 WP_000122983.1.1014 WP_000122983.1.101409 WP_000122983.1.101413 WP_000122983.1.10147 WP_000122983.1.101515 WP_000122983.1.101574 WP_000122983.1.101742 WP_000122983.1.101810 WP_000122983.1.101812 WP_000122983.1.101850 WP_000122983.1.101885 WP_000122983.1.101910 WP_000122983.1.101976 WP_000122983.1.101995 WP_000122983.1.102023 WP_000122983.1.102025 WP_000122983.1.102081 WP_000122983.1.102110 WP_000122983.1.10256 WP_000122983.1.10288 WP_000122983.1.10375 WP_000122983.1.10403 WP_000122983.1.10466 WP_000122983.1.10512 WP_000122983.1.10649 WP_000122983.1.1065 WP_000122983.1.10725 WP_000122983.1.10768 WP_000122983.1.10777 WP_000122983.1.10832 WP_000122983.1.10838 WP_000122983.1.10852 WP_000122983.1.11003 WP_000122983.1.11016 WP_000122983.1.11019 WP_000122983.1.11090 WP_000122983.1.11135 WP_000122983.1.11203 WP_000122983.1.11206 WP_000122983.1.11374 WP_000122983.1.1155 WP_000122983.1.11698 WP_000122983.1.11766 WP_000122983.1.11813 WP_000122983.1.11910 WP_000122983.1.11923 WP_000122983.1.11925 WP_000122983.1.11926 WP_000122983.1.1194 WP_000122983.1.11989 WP_000122983.1.12109 WP_000122983.1.1216 WP_000122983.1.12250 WP_000122983.1.12322 WP_000122983.1.12358 WP_000122983.1.12414 WP_000122983.1.12529 WP_000122983.1.12617 WP_000122983.1.12638 WP_000122983.1.1270 WP_000122983.1.12702 WP_000122983.1.12796 WP_000122983.1.12818 WP_000122983.1.1283 WP_000122983.1.12837 WP_000122983.1.12912 WP_000122983.1.13047 WP_000122983.1.13078 WP_000122983.1.13109 WP_000122983.1.13124 WP_000122983.1.13137 WP_000122983.1.1317 WP_000122983.1.13195 WP_000122983.1.13480 WP_000122983.1.13485 WP_000122983.1.13516 WP_000122983.1.13521 WP_000122983.1.13596 WP_000122983.1.13616 WP_000122983.1.13635 WP_000122983.1.13651 WP_000122983.1.13675 WP_000122983.1.13761 WP_000122983.1.13821 WP_000122983.1.13850 WP_000122983.1.13871 WP_000122983.1.13894 WP_000122983.1.13916 WP_000122983.1.1396 WP_000122983.1.14020 WP_000122983.1.1411 WP_000122983.1.14187 WP_000122983.1.14271 WP_000122983.1.14354 WP_000122983.1.14385 WP_000122983.1.14392 WP_000122983.1.14479 WP_000122983.1.14515 WP_000122983.1.14650 WP_000122983.1.14700 WP_000122983.1.14756 WP_000122983.1.14801 WP_000122983.1.14829 WP_000122983.1.14853 WP_000122983.1.14854 WP_000122983.1.14909 WP_000122983.1.14915 WP_000122983.1.15105 WP_000122983.1.15166 WP_000122983.1.15289 WP_000122983.1.15383 WP_000122983.1.15428 WP_000122983.1.15462 WP_000122983.1.15465 WP_000122983.1.15497 WP_000122983.1.15651 WP_000122983.1.15653 WP_000122983.1.15656 WP_000122983.1.15695 WP_000122983.1.15736 WP_000122983.1.15778 WP_000122983.1.15793 WP_000122983.1.15821 WP_000122983.1.15947 WP_000122983.1.16011 WP_000122983.1.16092 WP_000122983.1.16178 WP_000122983.1.16202 WP_000122983.1.16325 WP_000122983.1.16371 WP_000122983.1.1639 WP_000122983.1.16411 WP_000122983.1.16434 WP_000122983.1.16510 WP_000122983.1.1656 WP_000122983.1.16576 WP_000122983.1.16578 WP_000122983.1.1658 WP_000122983.1.16610 WP_000122983.1.16699 WP_000122983.1.16701 WP_000122983.1.16717 WP_000122983.1.16760 WP_000122983.1.16787 WP_000122983.1.16850 WP_000122983.1.16864 WP_000122983.1.16993 WP_000122983.1.17002 WP_000122983.1.17021 WP_000122983.1.17097 WP_000122983.1.17244 WP_000122983.1.17394 WP_000122983.1.17414 WP_000122983.1.17433 WP_000122983.1.17468 WP_000122983.1.17492 WP_000122983.1.1753 WP_000122983.1.17632 WP_000122983.1.17646 WP_000122983.1.17664 WP_000122983.1.17752 WP_000122983.1.17754 WP_000122983.1.17781 WP_000122983.1.18082 WP_000122983.1.18238 WP_000122983.1.18246 WP_000122983.1.18286 WP_000122983.1.18293 WP_000122983.1.18499 WP_000122983.1.18546 WP_000122983.1.1863 WP_000122983.1.18701 WP_000122983.1.18755 WP_000122983.1.18887 WP_000122983.1.19092 WP_000122983.1.1910 WP_000122983.1.19120 WP_000122983.1.19131 WP_000122983.1.1916 WP_000122983.1.19168 WP_000122983.1.19339 WP_000122983.1.19396 WP_000122983.1.19475 WP_000122983.1.19531 WP_000122983.1.19617 WP_000122983.1.19750 WP_000122983.1.19826 WP_000122983.1.1984 WP_000122983.1.19877 WP_000122983.1.1995 WP_000122983.1.20066 WP_000122983.1.20172 WP_000122983.1.20176 WP_000122983.1.20194 WP_000122983.1.20198 WP_000122983.1.20306 WP_000122983.1.2033 WP_000122983.1.2039 WP_000122983.1.20444 WP_000122983.1.20534 WP_000122983.1.20571 WP_000122983.1.20748 WP_000122983.1.20807 WP_000122983.1.20816 WP_000122983.1.20817 WP_000122983.1.20830 WP_000122983.1.20889 WP_000122983.1.20948 WP_000122983.1.20987 WP_000122983.1.20998 WP_000122983.1.21032 WP_000122983.1.21112 WP_000122983.1.21117 WP_000122983.1.21190 WP_000122983.1.21264 WP_000122983.1.21337 WP_000122983.1.21342 WP_000122983.1.21484 WP_000122983.1.21662 WP_000122983.1.21689 WP_000122983.1.21747 WP_000122983.1.21798 WP_000122983.1.22047 WP_000122983.1.22053 WP_000122983.1.22073 WP_000122983.1.2215 WP_000122983.1.22209 WP_000122983.1.22216 WP_000122983.1.22286 WP_000122983.1.22301 WP_000122983.1.22349 WP_000122983.1.22396 WP_000122983.1.22452 WP_000122983.1.22469 WP_000122983.1.22515 WP_000122983.1.22529 WP_000122983.1.22586 WP_000122983.1.22847 WP_000122983.1.23023 WP_000122983.1.23141 WP_000122983.1.23173 WP_000122983.1.23176 WP_000122983.1.23243 WP_000122983.1.23328 WP_000122983.1.23401 WP_000122983.1.23595 WP_000122983.1.23596 WP_000122983.1.23669 WP_000122983.1.23821 WP_000122983.1.2386 WP_000122983.1.23975 WP_000122983.1.23997 WP_000122983.1.24015 WP_000122983.1.24041 WP_000122983.1.24105 WP_000122983.1.24152 WP_000122983.1.24178 WP_000122983.1.24292 WP_000122983.1.24373 WP_000122983.1.2445 WP_000122983.1.24545 WP_000122983.1.24611 WP_000122983.1.24706 WP_000122983.1.24740 WP_000122983.1.2475 WP_000122983.1.24750 WP_000122983.1.24916 WP_000122983.1.24924 WP_000122983.1.24927 WP_000122983.1.25055 WP_000122983.1.25091 WP_000122983.1.25131 WP_000122983.1.25143 WP_000122983.1.25478 WP_000122983.1.25519 WP_000122983.1.25524 WP_000122983.1.2559 WP_000122983.1.2561 WP_000122983.1.25638 WP_000122983.1.25689 WP_000122983.1.25723 WP_000122983.1.2585 WP_000122983.1.25850 WP_000122983.1.25971 WP_000122983.1.26151 WP_000122983.1.26181 WP_000122983.1.26204 WP_000122983.1.26215 WP_000122983.1.2626 WP_000122983.1.26352 WP_000122983.1.2641 WP_000122983.1.26425 WP_000122983.1.26436 WP_000122983.1.26472 WP_000122983.1.26504 WP_000122983.1.26528 WP_000122983.1.26647 WP_000122983.1.26649 WP_000122983.1.26678 WP_000122983.1.26701 WP_000122983.1.26715 WP_000122983.1.26744 WP_000122983.1.26921 WP_000122983.1.26946 WP_000122983.1.27109 WP_000122983.1.27156 WP_000122983.1.27176 WP_000122983.1.2722 WP_000122983.1.27265 WP_000122983.1.273 WP_000122983.1.2730 WP_000122983.1.27346 WP_000122983.1.2738 WP_000122983.1.27506 WP_000122983.1.2762 WP_000122983.1.27623 WP_000122983.1.27656 WP_000122983.1.2769 WP_000122983.1.27704 WP_000122983.1.27731 WP_000122983.1.27737 WP_000122983.1.27801 WP_000122983.1.27840 WP_000122983.1.27845 WP_000122983.1.27852 WP_000122983.1.27934 WP_000122983.1.27983 WP_000122983.1.28048 WP_000122983.1.2810 WP_000122983.1.28101 WP_000122983.1.28141 WP_000122983.1.28188 WP_000122983.1.28204 WP_000122983.1.28234 WP_000122983.1.28246 WP_000122983.1.28320 WP_000122983.1.28385 WP_000122983.1.28405 WP_000122983.1.28411 WP_000122983.1.28420 WP_000122983.1.28456 WP_000122983.1.28507 WP_000122983.1.28513 WP_000122983.1.28581 WP_000122983.1.28601 WP_000122983.1.28774 WP_000122983.1.28778 WP_000122983.1.2884 WP_000122983.1.28883 WP_000122983.1.28898 WP_000122983.1.28937 WP_000122983.1.28988 WP_000122983.1.29047 WP_000122983.1.29117 WP_000122983.1.29123 WP_000122983.1.29216 WP_000122983.1.29229 WP_000122983.1.29347 WP_000122983.1.29455 WP_000122983.1.29589 WP_000122983.1.29672 WP_000122983.1.29779 WP_000122983.1.2979 WP_000122983.1.29806 WP_000122983.1.29817 WP_000122983.1.29824 WP_000122983.1.29897 WP_000122983.1.29927 WP_000122983.1.29955 WP_000122983.1.30083 WP_000122983.1.30173 WP_000122983.1.30309 WP_000122983.1.30407 WP_000122983.1.30490 WP_000122983.1.30498 WP_000122983.1.30597 WP_000122983.1.30611 WP_000122983.1.30667 WP_000122983.1.30673 WP_000122983.1.30739 WP_000122983.1.3075 WP_000122983.1.30776 WP_000122983.1.30856 WP_000122983.1.30932 WP_000122983.1.30969 WP_000122983.1.30996 WP_000122983.1.31121 WP_000122983.1.3116 WP_000122983.1.31187 WP_000122983.1.31237 WP_000122983.1.31312 WP_000122983.1.31328 WP_000122983.1.31345 WP_000122983.1.31430 WP_000122983.1.3144 WP_000122983.1.3162 WP_000122983.1.3163 WP_000122983.1.31729 WP_000122983.1.31810 WP_000122983.1.31834 WP_000122983.1.31917 WP_000122983.1.3198 WP_000122983.1.31980 WP_000122983.1.32028 WP_000122983.1.32065 WP_000122983.1.32129 WP_000122983.1.32223 WP_000122983.1.3225 WP_000122983.1.32257 WP_000122983.1.32374 WP_000122983.1.32487 WP_000122983.1.32512 WP_000122983.1.32532 WP_000122983.1.32579 WP_000122983.1.32666 WP_000122983.1.32682 WP_000122983.1.32830 WP_000122983.1.32845 WP_000122983.1.32847 WP_000122983.1.32956 WP_000122983.1.32983 WP_000122983.1.3303 WP_000122983.1.33104 WP_000122983.1.33154 WP_000122983.1.33198 WP_000122983.1.33262 WP_000122983.1.33308 WP_000122983.1.33370 WP_000122983.1.33386 WP_000122983.1.33423 WP_000122983.1.33447 WP_000122983.1.3346 WP_000122983.1.33495 WP_000122983.1.33541 WP_000122983.1.33558 WP_000122983.1.33679 WP_000122983.1.33684 WP_000122983.1.33706 WP_000122983.1.33714 WP_000122983.1.33759 WP_000122983.1.33773 WP_000122983.1.33777 WP_000122983.1.33805 WP_000122983.1.33871 WP_000122983.1.33902 WP_000122983.1.33929 WP_000122983.1.33931 WP_000122983.1.33962 WP_000122983.1.33978 WP_000122983.1.34027 WP_000122983.1.34045 WP_000122983.1.34049 WP_000122983.1.34077 WP_000122983.1.34207 WP_000122983.1.34313 WP_000122983.1.34394 WP_000122983.1.34577 WP_000122983.1.34618 WP_000122983.1.34642 WP_000122983.1.34789 WP_000122983.1.34859 WP_000122983.1.34917 WP_000122983.1.35000 WP_000122983.1.35018 WP_000122983.1.35046 WP_000122983.1.35199 WP_000122983.1.35242 WP_000122983.1.35250 WP_000122983.1.35273 WP_000122983.1.35327 WP_000122983.1.3535 WP_000122983.1.35434 WP_000122983.1.35461 WP_000122983.1.35565 WP_000122983.1.35588 WP_000122983.1.35601 WP_000122983.1.3567 WP_000122983.1.35715 WP_000122983.1.35717 WP_000122983.1.35728 WP_000122983.1.35758 WP_000122983.1.35761 WP_000122983.1.35828 WP_000122983.1.35883 WP_000122983.1.3592 WP_000122983.1.36030 WP_000122983.1.36110 WP_000122983.1.36122 WP_000122983.1.3622 WP_000122983.1.36327 WP_000122983.1.36355 WP_000122983.1.36381 WP_000122983.1.36418 WP_000122983.1.36517 WP_000122983.1.36549 WP_000122983.1.36569 WP_000122983.1.36694 WP_000122983.1.36714 WP_000122983.1.36735 WP_000122983.1.36866 WP_000122983.1.36869 WP_000122983.1.3712 WP_000122983.1.37180 WP_000122983.1.37215 WP_000122983.1.37386 WP_000122983.1.37406 WP_000122983.1.37437 WP_000122983.1.3755 WP_000122983.1.37553 WP_000122983.1.3758 WP_000122983.1.37603 WP_000122983.1.37607 WP_000122983.1.37680 WP_000122983.1.37729 WP_000122983.1.37803 WP_000122983.1.37807 WP_000122983.1.37893 WP_000122983.1.37963 WP_000122983.1.37982 WP_000122983.1.38009 WP_000122983.1.38122 WP_000122983.1.38249 WP_000122983.1.38320 WP_000122983.1.3836 WP_000122983.1.3843 WP_000122983.1.3856 WP_000122983.1.38628 WP_000122983.1.38689 WP_000122983.1.38696 WP_000122983.1.38701 WP_000122983.1.38732 WP_000122983.1.38748 WP_000122983.1.38758 WP_000122983.1.38759 WP_000122983.1.38779 WP_000122983.1.38883 WP_000122983.1.38901 WP_000122983.1.39159 WP_000122983.1.39353 WP_000122983.1.39598 WP_000122983.1.39680 WP_000122983.1.39688 WP_000122983.1.397 WP_000122983.1.3974 WP_000122983.1.39799 WP_000122983.1.39901 WP_000122983.1.39911 WP_000122983.1.39927 WP_000122983.1.39928 WP_000122983.1.40199 WP_000122983.1.40200 WP_000122983.1.40225 WP_000122983.1.40233 WP_000122983.1.4029 WP_000122983.1.40297 WP_000122983.1.40332 WP_000122983.1.4047 WP_000122983.1.40490 WP_000122983.1.40497 WP_000122983.1.40547 WP_000122983.1.40559 WP_000122983.1.40645 WP_000122983.1.40679 WP_000122983.1.40832 WP_000122983.1.40836 WP_000122983.1.40845 WP_000122983.1.4086 WP_000122983.1.40947 WP_000122983.1.41026 WP_000122983.1.41029 WP_000122983.1.41059 WP_000122983.1.4110 WP_000122983.1.41201 WP_000122983.1.41395 WP_000122983.1.41425 WP_000122983.1.41507 WP_000122983.1.4164 WP_000122983.1.41707 WP_000122983.1.41710 WP_000122983.1.41720 WP_000122983.1.41738 WP_000122983.1.41878 WP_000122983.1.4191 WP_000122983.1.41922 WP_000122983.1.41934 WP_000122983.1.41936 WP_000122983.1.42011 WP_000122983.1.42080 WP_000122983.1.42143 WP_000122983.1.42172 WP_000122983.1.42253 WP_000122983.1.42289 WP_000122983.1.42351 WP_000122983.1.42377 WP_000122983.1.42401 WP_000122983.1.42484 WP_000122983.1.4253 WP_000122983.1.42531 WP_000122983.1.42561 WP_000122983.1.42571 WP_000122983.1.42581 WP_000122983.1.42708 WP_000122983.1.42721 WP_000122983.1.4277 WP_000122983.1.42773 WP_000122983.1.4281 WP_000122983.1.42824 WP_000122983.1.42888 WP_000122983.1.42928 WP_000122983.1.43011 WP_000122983.1.43028 WP_000122983.1.43094 WP_000122983.1.431 WP_000122983.1.4311 WP_000122983.1.43175 WP_000122983.1.43203 WP_000122983.1.43227 WP_000122983.1.43340 WP_000122983.1.43439 WP_000122983.1.43641 WP_000122983.1.43645 WP_000122983.1.43672 WP_000122983.1.43759 WP_000122983.1.43761 WP_000122983.1.43766 WP_000122983.1.43891 WP_000122983.1.4396 WP_000122983.1.43978 WP_000122983.1.44009 WP_000122983.1.44052 WP_000122983.1.44058 WP_000122983.1.44126 WP_000122983.1.44244 WP_000122983.1.44275 WP_000122983.1.443 WP_000122983.1.44342 WP_000122983.1.44370 WP_000122983.1.44372 WP_000122983.1.44385 WP_000122983.1.44407 WP_000122983.1.44419 WP_000122983.1.44613 WP_000122983.1.44664 WP_000122983.1.44684 WP_000122983.1.44770 WP_000122983.1.44809 WP_000122983.1.44816 WP_000122983.1.4484 WP_000122983.1.44886 WP_000122983.1.44926 WP_000122983.1.44929 WP_000122983.1.44944 WP_000122983.1.44964 WP_000122983.1.44974 WP_000122983.1.45149 WP_000122983.1.45233 WP_000122983.1.45291 WP_000122983.1.45307 WP_000122983.1.4537 WP_000122983.1.45399 WP_000122983.1.45418 WP_000122983.1.45457 WP_000122983.1.4548 WP_000122983.1.45587 WP_000122983.1.45608 WP_000122983.1.45637 WP_000122983.1.45647 WP_000122983.1.45675 WP_000122983.1.45761 WP_000122983.1.45839 WP_000122983.1.45916 WP_000122983.1.45966 WP_000122983.1.46080 WP_000122983.1.46108 WP_000122983.1.46114 WP_000122983.1.46126 WP_000122983.1.46138 WP_000122983.1.46194 WP_000122983.1.46255 WP_000122983.1.46258 WP_000122983.1.46337 WP_000122983.1.46338 WP_000122983.1.46385 WP_000122983.1.46413 WP_000122983.1.46417 WP_000122983.1.46474 WP_000122983.1.4648 WP_000122983.1.46493 WP_000122983.1.46518 WP_000122983.1.46577 WP_000122983.1.46645 WP_000122983.1.46739 WP_000122983.1.46762 WP_000122983.1.46850 WP_000122983.1.46887 WP_000122983.1.46896 WP_000122983.1.46918 WP_000122983.1.46950 WP_000122983.1.46959 WP_000122983.1.47070 WP_000122983.1.47141 WP_000122983.1.47219 WP_000122983.1.47241 WP_000122983.1.4733 WP_000122983.1.47388 WP_000122983.1.47436 WP_000122983.1.47515 WP_000122983.1.47543 WP_000122983.1.47552 WP_000122983.1.47553 WP_000122983.1.47573 WP_000122983.1.4761 WP_000122983.1.47715 WP_000122983.1.47816 WP_000122983.1.47828 WP_000122983.1.47863 WP_000122983.1.47903 WP_000122983.1.47917 WP_000122983.1.48026 WP_000122983.1.48042 WP_000122983.1.48115 WP_000122983.1.4819 WP_000122983.1.4824 WP_000122983.1.48270 WP_000122983.1.48280 WP_000122983.1.48320 WP_000122983.1.48380 WP_000122983.1.48415 WP_000122983.1.48451 WP_000122983.1.48457 WP_000122983.1.48485 WP_000122983.1.48495 WP_000122983.1.48509 WP_000122983.1.48527 WP_000122983.1.48529 WP_000122983.1.4855 WP_000122983.1.48642 WP_000122983.1.48692 WP_000122983.1.48700 WP_000122983.1.48717 WP_000122983.1.48785 WP_000122983.1.48824 WP_000122983.1.4887 WP_000122983.1.489 WP_000122983.1.48925 WP_000122983.1.48977 WP_000122983.1.49083 WP_000122983.1.4925 WP_000122983.1.49261 WP_000122983.1.49318 WP_000122983.1.4935 WP_000122983.1.49380 WP_000122983.1.49405 WP_000122983.1.4941 WP_000122983.1.49410 WP_000122983.1.49463 WP_000122983.1.49564 WP_000122983.1.49584 WP_000122983.1.49639 WP_000122983.1.4967 WP_000122983.1.49673 WP_000122983.1.49701 WP_000122983.1.49705 WP_000122983.1.49789 WP_000122983.1.49866 WP_000122983.1.49896 WP_000122983.1.49928 WP_000122983.1.49938 WP_000122983.1.49960 WP_000122983.1.49993 WP_000122983.1.5 WP_000122983.1.50011 WP_000122983.1.50097 WP_000122983.1.50111 WP_000122983.1.50135 WP_000122983.1.5014 WP_000122983.1.50150 WP_000122983.1.50216 WP_000122983.1.50220 WP_000122983.1.50267 WP_000122983.1.50298 WP_000122983.1.503 WP_000122983.1.50617 WP_000122983.1.50705 WP_000122983.1.50789 WP_000122983.1.50807 WP_000122983.1.50815 WP_000122983.1.50859 WP_000122983.1.50892 WP_000122983.1.50998 WP_000122983.1.51063 WP_000122983.1.51254 WP_000122983.1.51314 WP_000122983.1.51328 WP_000122983.1.51369 WP_000122983.1.51437 WP_000122983.1.51569 WP_000122983.1.51578 WP_000122983.1.51597 WP_000122983.1.51620 WP_000122983.1.51640 WP_000122983.1.51663 WP_000122983.1.51709 WP_000122983.1.5171 WP_000122983.1.51805 WP_000122983.1.51856 WP_000122983.1.51876 WP_000122983.1.5193 WP_000122983.1.51966 WP_000122983.1.52030 WP_000122983.1.52032 WP_000122983.1.5206 WP_000122983.1.52103 WP_000122983.1.52138 WP_000122983.1.52189 WP_000122983.1.5220 WP_000122983.1.52310 WP_000122983.1.52325 WP_000122983.1.52338 WP_000122983.1.52342 WP_000122983.1.52392 WP_000122983.1.52394 WP_000122983.1.52445 WP_000122983.1.52619 WP_000122983.1.5274 WP_000122983.1.52766 WP_000122983.1.52806 WP_000122983.1.5281 WP_000122983.1.52839 WP_000122983.1.52840 WP_000122983.1.52885 WP_000122983.1.52935 WP_000122983.1.52955 WP_000122983.1.52980 WP_000122983.1.52982 WP_000122983.1.5300 WP_000122983.1.53023 WP_000122983.1.53052 WP_000122983.1.53144 WP_000122983.1.53146 WP_000122983.1.53284 WP_000122983.1.53390 WP_000122983.1.53424 WP_000122983.1.53498 WP_000122983.1.53510 WP_000122983.1.53533 WP_000122983.1.53539 WP_000122983.1.53593 WP_000122983.1.53616 WP_000122983.1.53638 WP_000122983.1.53703 WP_000122983.1.53708 WP_000122983.1.53740 WP_000122983.1.53762 WP_000122983.1.53854 WP_000122983.1.53954 WP_000122983.1.53965 WP_000122983.1.53985 WP_000122983.1.54 WP_000122983.1.54055 WP_000122983.1.54088 WP_000122983.1.54108 WP_000122983.1.5412 WP_000122983.1.54138 WP_000122983.1.54139 WP_000122983.1.54171 WP_000122983.1.54242 WP_000122983.1.54266 WP_000122983.1.54300 WP_000122983.1.54352 WP_000122983.1.54451 WP_000122983.1.54464 WP_000122983.1.54566 WP_000122983.1.54581 WP_000122983.1.54664 WP_000122983.1.54670 WP_000122983.1.54712 WP_000122983.1.54718 WP_000122983.1.54761 WP_000122983.1.54842 WP_000122983.1.54885 WP_000122983.1.5489 WP_000122983.1.54906 WP_000122983.1.54963 WP_000122983.1.54977 WP_000122983.1.55062 WP_000122983.1.55096 WP_000122983.1.55155 WP_000122983.1.55201 WP_000122983.1.55321 WP_000122983.1.55363 WP_000122983.1.55368 WP_000122983.1.55376 WP_000122983.1.55408 WP_000122983.1.55447 WP_000122983.1.55457 WP_000122983.1.55491 WP_000122983.1.55516 WP_000122983.1.55592 WP_000122983.1.55773 WP_000122983.1.55799 WP_000122983.1.55997 WP_000122983.1.56027 WP_000122983.1.56076 WP_000122983.1.56102 WP_000122983.1.56129 WP_000122983.1.56165 WP_000122983.1.56211 WP_000122983.1.56246 WP_000122983.1.5626 WP_000122983.1.56379 WP_000122983.1.56538 WP_000122983.1.56705 WP_000122983.1.56712 WP_000122983.1.56717 WP_000122983.1.56798 WP_000122983.1.56841 WP_000122983.1.56991 WP_000122983.1.57078 WP_000122983.1.57250 WP_000122983.1.57346 WP_000122983.1.57392 WP_000122983.1.57408 WP_000122983.1.57423 WP_000122983.1.57457 WP_000122983.1.57463 WP_000122983.1.57535 WP_000122983.1.57543 WP_000122983.1.57606 WP_000122983.1.57654 WP_000122983.1.57829 WP_000122983.1.57842 WP_000122983.1.57874 WP_000122983.1.58061 WP_000122983.1.58115 WP_000122983.1.5814 WP_000122983.1.58159 WP_000122983.1.5822 WP_000122983.1.58269 WP_000122983.1.58319 WP_000122983.1.58337 WP_000122983.1.58453 WP_000122983.1.58503 WP_000122983.1.58570 WP_000122983.1.58621 WP_000122983.1.58802 WP_000122983.1.58969 WP_000122983.1.590 WP_000122983.1.59078 WP_000122983.1.5908 WP_000122983.1.59107 WP_000122983.1.59118 WP_000122983.1.59232 WP_000122983.1.59281 WP_000122983.1.59325 WP_000122983.1.59354 WP_000122983.1.59416 WP_000122983.1.59417 WP_000122983.1.59450 WP_000122983.1.59476 WP_000122983.1.59488 WP_000122983.1.5961 WP_000122983.1.59649 WP_000122983.1.59754 WP_000122983.1.59765 WP_000122983.1.59769 WP_000122983.1.59802 WP_000122983.1.5988 WP_000122983.1.59897 WP_000122983.1.59944 WP_000122983.1.59957 WP_000122983.1.600 WP_000122983.1.60059 WP_000122983.1.60099 WP_000122983.1.60108 WP_000122983.1.60116 WP_000122983.1.60144 WP_000122983.1.60176 WP_000122983.1.60182 WP_000122983.1.60198 WP_000122983.1.60243 WP_000122983.1.60316 WP_000122983.1.60318 WP_000122983.1.60359 WP_000122983.1.60474 WP_000122983.1.60542 WP_000122983.1.60546 WP_000122983.1.60581 WP_000122983.1.60589 WP_000122983.1.60609 WP_000122983.1.60616 WP_000122983.1.60655 WP_000122983.1.60669 WP_000122983.1.60678 WP_000122983.1.60697 WP_000122983.1.60894 WP_000122983.1.60933 WP_000122983.1.61105 WP_000122983.1.6112 WP_000122983.1.61172 WP_000122983.1.61173 WP_000122983.1.61291 WP_000122983.1.61336 WP_000122983.1.61410 WP_000122983.1.61441 WP_000122983.1.61477 WP_000122983.1.61516 WP_000122983.1.61527 WP_000122983.1.61578 WP_000122983.1.61637 WP_000122983.1.61704 WP_000122983.1.61759 WP_000122983.1.61974 WP_000122983.1.62032 WP_000122983.1.62067 WP_000122983.1.62150 WP_000122983.1.6221 WP_000122983.1.62242 WP_000122983.1.62308 WP_000122983.1.624 WP_000122983.1.62428 WP_000122983.1.62543 WP_000122983.1.62549 WP_000122983.1.62622 WP_000122983.1.62712 WP_000122983.1.62732 WP_000122983.1.62767 WP_000122983.1.6277 WP_000122983.1.62800 WP_000122983.1.62817 WP_000122983.1.62868 WP_000122983.1.6289 WP_000122983.1.62924 WP_000122983.1.63028 WP_000122983.1.63219 WP_000122983.1.63224 WP_000122983.1.63274 WP_000122983.1.63303 WP_000122983.1.63340 WP_000122983.1.63354 WP_000122983.1.63391 WP_000122983.1.63405 WP_000122983.1.63426 WP_000122983.1.6352 WP_000122983.1.63636 WP_000122983.1.63639 WP_000122983.1.63649 WP_000122983.1.63796 WP_000122983.1.63857 WP_000122983.1.63906 WP_000122983.1.63933 WP_000122983.1.63949 WP_000122983.1.64044 WP_000122983.1.64177 WP_000122983.1.64214 WP_000122983.1.64218 WP_000122983.1.64310 WP_000122983.1.6434 WP_000122983.1.64428 WP_000122983.1.64465 WP_000122983.1.6454 WP_000122983.1.6458 WP_000122983.1.64586 WP_000122983.1.64604 WP_000122983.1.64610 WP_000122983.1.64639 WP_000122983.1.64646 WP_000122983.1.64658 WP_000122983.1.64761 WP_000122983.1.64834 WP_000122983.1.64907 WP_000122983.1.64955 WP_000122983.1.64964 WP_000122983.1.65003 WP_000122983.1.65005 WP_000122983.1.65058 WP_000122983.1.65080 WP_000122983.1.6513 WP_000122983.1.65154 WP_000122983.1.65267 WP_000122983.1.65325 WP_000122983.1.65373 WP_000122983.1.65434 WP_000122983.1.65506 WP_000122983.1.65527 WP_000122983.1.65556 WP_000122983.1.65560 WP_000122983.1.65630 WP_000122983.1.65680 WP_000122983.1.65804 WP_000122983.1.65866 WP_000122983.1.65872 WP_000122983.1.65890 WP_000122983.1.65939 WP_000122983.1.65955 WP_000122983.1.65970 WP_000122983.1.65995 WP_000122983.1.66140 WP_000122983.1.66142 WP_000122983.1.66189 WP_000122983.1.66200 WP_000122983.1.66210 WP_000122983.1.66215 WP_000122983.1.66431 WP_000122983.1.66458 WP_000122983.1.66475 WP_000122983.1.66496 WP_000122983.1.66541 WP_000122983.1.66591 WP_000122983.1.66636 WP_000122983.1.66689 WP_000122983.1.66691 WP_000122983.1.66716 WP_000122983.1.66717 WP_000122983.1.66771 WP_000122983.1.66782 WP_000122983.1.66806 WP_000122983.1.66960 WP_000122983.1.66972 WP_000122983.1.67003 WP_000122983.1.67009 WP_000122983.1.67141 WP_000122983.1.6717 WP_000122983.1.67361 WP_000122983.1.67419 WP_000122983.1.67426 WP_000122983.1.67486 WP_000122983.1.67500 WP_000122983.1.67597 WP_000122983.1.67601 WP_000122983.1.67656 WP_000122983.1.67661 WP_000122983.1.6767 WP_000122983.1.67728 WP_000122983.1.67746 WP_000122983.1.67862 WP_000122983.1.67869 WP_000122983.1.67895 WP_000122983.1.67922 WP_000122983.1.67939 WP_000122983.1.68013 WP_000122983.1.68024 WP_000122983.1.68065 WP_000122983.1.68087 WP_000122983.1.68119 WP_000122983.1.68132 WP_000122983.1.68168 WP_000122983.1.6820 WP_000122983.1.68225 WP_000122983.1.68258 WP_000122983.1.68315 WP_000122983.1.6841 WP_000122983.1.68428 WP_000122983.1.68454 WP_000122983.1.6847 WP_000122983.1.6851 WP_000122983.1.6861 WP_000122983.1.68698 WP_000122983.1.68705 WP_000122983.1.68726 WP_000122983.1.68830 WP_000122983.1.68837 WP_000122983.1.68858 WP_000122983.1.68885 WP_000122983.1.689 WP_000122983.1.68904 WP_000122983.1.68933 WP_000122983.1.69024 WP_000122983.1.69046 WP_000122983.1.69117 WP_000122983.1.69121 WP_000122983.1.69172 WP_000122983.1.69193 WP_000122983.1.69253 WP_000122983.1.69257 WP_000122983.1.69364 WP_000122983.1.69379 WP_000122983.1.69419 WP_000122983.1.69478 WP_000122983.1.6952 WP_000122983.1.69586 WP_000122983.1.69609 WP_000122983.1.69665 WP_000122983.1.69815 WP_000122983.1.69929 WP_000122983.1.7002 WP_000122983.1.70025 WP_000122983.1.70154 WP_000122983.1.70197 WP_000122983.1.70283 WP_000122983.1.70297 WP_000122983.1.70461 WP_000122983.1.70542 WP_000122983.1.70891 WP_000122983.1.70993 WP_000122983.1.71004 WP_000122983.1.71005 WP_000122983.1.71131 WP_000122983.1.71151 WP_000122983.1.71204 WP_000122983.1.71220 WP_000122983.1.71335 WP_000122983.1.71340 WP_000122983.1.71362 WP_000122983.1.71413 WP_000122983.1.71435 WP_000122983.1.71508 WP_000122983.1.71539 WP_000122983.1.71616 WP_000122983.1.71719 WP_000122983.1.7172 WP_000122983.1.71823 WP_000122983.1.71825 WP_000122983.1.71857 WP_000122983.1.71876 WP_000122983.1.71969 WP_000122983.1.71971 WP_000122983.1.72010 WP_000122983.1.72081 WP_000122983.1.7213 WP_000122983.1.72158 WP_000122983.1.72265 WP_000122983.1.72295 WP_000122983.1.72299 WP_000122983.1.72334 WP_000122983.1.72430 WP_000122983.1.72476 WP_000122983.1.72512 WP_000122983.1.72997 WP_000122983.1.73031 WP_000122983.1.73056 WP_000122983.1.73076 WP_000122983.1.73218 WP_000122983.1.73238 WP_000122983.1.73341 WP_000122983.1.73347 WP_000122983.1.73348 WP_000122983.1.73375 WP_000122983.1.73434 WP_000122983.1.73446 WP_000122983.1.73542 WP_000122983.1.73636 WP_000122983.1.73645 WP_000122983.1.73699 WP_000122983.1.73727 WP_000122983.1.73779 WP_000122983.1.73806 WP_000122983.1.73867 WP_000122983.1.73874 WP_000122983.1.73875 WP_000122983.1.73932 WP_000122983.1.73938 WP_000122983.1.74122 WP_000122983.1.74312 WP_000122983.1.74318 WP_000122983.1.74324 WP_000122983.1.74361 WP_000122983.1.74393 WP_000122983.1.74451 WP_000122983.1.74463 WP_000122983.1.7453 WP_000122983.1.74700 WP_000122983.1.74709 WP_000122983.1.74711 WP_000122983.1.74819 WP_000122983.1.74869 WP_000122983.1.74908 WP_000122983.1.74930 WP_000122983.1.74949 WP_000122983.1.74969 WP_000122983.1.75104 WP_000122983.1.75105 WP_000122983.1.75107 WP_000122983.1.75121 WP_000122983.1.7521 WP_000122983.1.75212 WP_000122983.1.75225 WP_000122983.1.75321 WP_000122983.1.75386 WP_000122983.1.75412 WP_000122983.1.75416 WP_000122983.1.75459 WP_000122983.1.75478 WP_000122983.1.75489 WP_000122983.1.75562 WP_000122983.1.75569 WP_000122983.1.75620 WP_000122983.1.75667 WP_000122983.1.75812 WP_000122983.1.75859 WP_000122983.1.75890 WP_000122983.1.75895 WP_000122983.1.75896 WP_000122983.1.75939 WP_000122983.1.76026 WP_000122983.1.7606 WP_000122983.1.76101 WP_000122983.1.76117 WP_000122983.1.76250 WP_000122983.1.76260 WP_000122983.1.76372 WP_000122983.1.76464 WP_000122983.1.76493 WP_000122983.1.7651 WP_000122983.1.76523 WP_000122983.1.76571 WP_000122983.1.76587 WP_000122983.1.76590 WP_000122983.1.7662 WP_000122983.1.76682 WP_000122983.1.76698 WP_000122983.1.76787 WP_000122983.1.76871 WP_000122983.1.76953 WP_000122983.1.76981 WP_000122983.1.77164 WP_000122983.1.77233 WP_000122983.1.77237 WP_000122983.1.77257 WP_000122983.1.77274 WP_000122983.1.77277 WP_000122983.1.77347 WP_000122983.1.77396 WP_000122983.1.77531 WP_000122983.1.77539 WP_000122983.1.7757 WP_000122983.1.77590 WP_000122983.1.77634 WP_000122983.1.77660 WP_000122983.1.77711 WP_000122983.1.77758 WP_000122983.1.77776 WP_000122983.1.77778 WP_000122983.1.77812 WP_000122983.1.77903 WP_000122983.1.77969 WP_000122983.1.77996 WP_000122983.1.78154 WP_000122983.1.7816 WP_000122983.1.78197 WP_000122983.1.78240 WP_000122983.1.7825 WP_000122983.1.78261 WP_000122983.1.78355 WP_000122983.1.78361 WP_000122983.1.78505 WP_000122983.1.78530 WP_000122983.1.78543 WP_000122983.1.78561 WP_000122983.1.7864 WP_000122983.1.7866 WP_000122983.1.78660 WP_000122983.1.78768 WP_000122983.1.78769 WP_000122983.1.78783 WP_000122983.1.78805 WP_000122983.1.78808 WP_000122983.1.78904 WP_000122983.1.78968 WP_000122983.1.78984 WP_000122983.1.79010 WP_000122983.1.79020 WP_000122983.1.79028 WP_000122983.1.79072 WP_000122983.1.79078 WP_000122983.1.7908 WP_000122983.1.79181 WP_000122983.1.7921 WP_000122983.1.79229 WP_000122983.1.79242 WP_000122983.1.79254 WP_000122983.1.79260 WP_000122983.1.79284 WP_000122983.1.793 WP_000122983.1.79328 WP_000122983.1.79405 WP_000122983.1.7947 WP_000122983.1.79470 WP_000122983.1.7949 WP_000122983.1.79567 WP_000122983.1.79701 WP_000122983.1.79720 WP_000122983.1.79728 WP_000122983.1.79736 WP_000122983.1.79774 WP_000122983.1.7978 WP_000122983.1.79789 WP_000122983.1.79797 WP_000122983.1.79889 WP_000122983.1.79909 WP_000122983.1.80125 WP_000122983.1.80138 WP_000122983.1.80143 WP_000122983.1.80162 WP_000122983.1.80195 WP_000122983.1.8021 WP_000122983.1.8039 WP_000122983.1.80528 WP_000122983.1.80585 WP_000122983.1.80655 WP_000122983.1.80665 WP_000122983.1.80686 WP_000122983.1.8071 WP_000122983.1.80712 WP_000122983.1.80730 WP_000122983.1.80887 WP_000122983.1.80897 WP_000122983.1.80905 WP_000122983.1.80987 WP_000122983.1.80989 WP_000122983.1.81002 WP_000122983.1.81068 WP_000122983.1.8108 WP_000122983.1.81146 WP_000122983.1.81161 WP_000122983.1.81238 WP_000122983.1.81240 WP_000122983.1.81253 WP_000122983.1.81294 WP_000122983.1.81319 WP_000122983.1.81345 WP_000122983.1.81365 WP_000122983.1.81373 WP_000122983.1.81400 WP_000122983.1.81412 WP_000122983.1.81441 WP_000122983.1.81466 WP_000122983.1.81700 WP_000122983.1.81704 WP_000122983.1.81764 WP_000122983.1.82036 WP_000122983.1.82040 WP_000122983.1.82090 WP_000122983.1.82110 WP_000122983.1.82203 WP_000122983.1.82235 WP_000122983.1.82286 WP_000122983.1.8230 WP_000122983.1.82366 WP_000122983.1.82371 WP_000122983.1.82489 WP_000122983.1.82504 WP_000122983.1.82538 WP_000122983.1.82561 WP_000122983.1.82633 WP_000122983.1.8264 WP_000122983.1.828 WP_000122983.1.82809 WP_000122983.1.82815 WP_000122983.1.82838 WP_000122983.1.82848 WP_000122983.1.82861 WP_000122983.1.82967 WP_000122983.1.83001 WP_000122983.1.8301 WP_000122983.1.83024 WP_000122983.1.83098 WP_000122983.1.83178 WP_000122983.1.83222 WP_000122983.1.83297 WP_000122983.1.83400 WP_000122983.1.83410 WP_000122983.1.83450 WP_000122983.1.83452 WP_000122983.1.83474 WP_000122983.1.8348 WP_000122983.1.83594 WP_000122983.1.836 WP_000122983.1.83679 WP_000122983.1.83693 WP_000122983.1.8377 WP_000122983.1.838 WP_000122983.1.83817 WP_000122983.1.83889 WP_000122983.1.8389 WP_000122983.1.839 WP_000122983.1.83900 WP_000122983.1.83970 WP_000122983.1.84012 WP_000122983.1.84099 WP_000122983.1.84139 WP_000122983.1.84171 WP_000122983.1.84173 WP_000122983.1.84189 WP_000122983.1.84247 WP_000122983.1.84250 WP_000122983.1.84318 WP_000122983.1.84332 WP_000122983.1.84387 WP_000122983.1.84447 WP_000122983.1.84490 WP_000122983.1.84527 WP_000122983.1.84536 WP_000122983.1.84550 WP_000122983.1.84571 WP_000122983.1.84618 WP_000122983.1.84663 WP_000122983.1.84688 WP_000122983.1.84691 WP_000122983.1.84706 WP_000122983.1.8472 WP_000122983.1.84769 WP_000122983.1.84864 WP_000122983.1.84898 WP_000122983.1.84921 WP_000122983.1.84944 WP_000122983.1.85149 WP_000122983.1.85158 WP_000122983.1.85168 WP_000122983.1.85185 WP_000122983.1.85254 WP_000122983.1.85279 WP_000122983.1.85299 WP_000122983.1.85359 WP_000122983.1.85364 WP_000122983.1.85449 WP_000122983.1.85493 WP_000122983.1.85544 WP_000122983.1.85616 WP_000122983.1.85683 WP_000122983.1.85711 WP_000122983.1.85743 WP_000122983.1.85833 WP_000122983.1.85846 WP_000122983.1.85889 WP_000122983.1.8596 WP_000122983.1.8601 WP_000122983.1.86100 WP_000122983.1.86163 WP_000122983.1.86180 WP_000122983.1.86242 WP_000122983.1.86277 WP_000122983.1.86324 WP_000122983.1.86336 WP_000122983.1.86385 WP_000122983.1.86715 WP_000122983.1.86869 WP_000122983.1.86890 WP_000122983.1.86908 WP_000122983.1.86922 WP_000122983.1.86966 WP_000122983.1.87024 WP_000122983.1.87048 WP_000122983.1.87099 WP_000122983.1.87111 WP_000122983.1.87142 WP_000122983.1.87292 WP_000122983.1.87312 WP_000122983.1.87319 WP_000122983.1.87562 WP_000122983.1.87567 WP_000122983.1.87598 WP_000122983.1.87727 WP_000122983.1.87746 WP_000122983.1.87805 WP_000122983.1.87830 WP_000122983.1.879 WP_000122983.1.88093 WP_000122983.1.88115 WP_000122983.1.88131 WP_000122983.1.88133 WP_000122983.1.88163 WP_000122983.1.88183 WP_000122983.1.885 WP_000122983.1.88512 WP_000122983.1.88596 WP_000122983.1.8860 WP_000122983.1.88613 WP_000122983.1.88654 WP_000122983.1.88842 WP_000122983.1.88851 WP_000122983.1.89030 WP_000122983.1.89107 WP_000122983.1.89172 WP_000122983.1.89199 WP_000122983.1.89289 WP_000122983.1.89376 WP_000122983.1.89383 WP_000122983.1.89412 WP_000122983.1.89419 WP_000122983.1.89454 WP_000122983.1.89459 WP_000122983.1.89484 WP_000122983.1.89568 WP_000122983.1.89611 WP_000122983.1.89643 WP_000122983.1.89653 WP_000122983.1.89685 WP_000122983.1.89724 WP_000122983.1.89790 WP_000122983.1.89792 WP_000122983.1.89836 WP_000122983.1.89876 WP_000122983.1.89906 WP_000122983.1.9008 WP_000122983.1.90087 WP_000122983.1.90118 WP_000122983.1.90132 WP_000122983.1.90262 WP_000122983.1.90310 WP_000122983.1.90375 WP_000122983.1.90378 WP_000122983.1.9038 WP_000122983.1.90413 WP_000122983.1.90584 WP_000122983.1.90656 WP_000122983.1.90743 WP_000122983.1.90755 WP_000122983.1.90781 WP_000122983.1.90795 WP_000122983.1.90932 WP_000122983.1.90943 WP_000122983.1.90945 WP_000122983.1.90953 WP_000122983.1.91061 WP_000122983.1.91085 WP_000122983.1.91147 WP_000122983.1.91199 WP_000122983.1.91206 WP_000122983.1.91241 WP_000122983.1.91249 WP_000122983.1.91286 WP_000122983.1.91335 WP_000122983.1.9134 WP_000122983.1.91477 WP_000122983.1.91502 WP_000122983.1.91523 WP_000122983.1.91612 WP_000122983.1.91627 WP_000122983.1.91696 WP_000122983.1.9172 WP_000122983.1.91752 WP_000122983.1.91754 WP_000122983.1.91762 WP_000122983.1.91780 WP_000122983.1.91832 WP_000122983.1.91854 WP_000122983.1.91906 WP_000122983.1.91908 WP_000122983.1.91941 WP_000122983.1.92128 WP_000122983.1.92179 WP_000122983.1.9228 WP_000122983.1.9233 WP_000122983.1.92365 WP_000122983.1.92417 WP_000122983.1.92468 WP_000122983.1.92515 WP_000122983.1.92578 WP_000122983.1.92611 WP_000122983.1.92623 WP_000122983.1.92665 WP_000122983.1.92749 WP_000122983.1.92945 WP_000122983.1.92998 WP_000122983.1.9309 WP_000122983.1.93094 WP_000122983.1.93114 WP_000122983.1.93151 WP_000122983.1.93280 WP_000122983.1.93437 WP_000122983.1.93451 WP_000122983.1.93482 WP_000122983.1.93485 WP_000122983.1.93594 WP_000122983.1.93682 WP_000122983.1.93778 WP_000122983.1.93796 WP_000122983.1.93849 WP_000122983.1.93868 WP_000122983.1.93948 WP_000122983.1.94012 WP_000122983.1.94015 WP_000122983.1.94034 WP_000122983.1.94129 WP_000122983.1.94265 WP_000122983.1.94387 WP_000122983.1.94410 WP_000122983.1.94502 WP_000122983.1.94581 WP_000122983.1.9472 WP_000122983.1.94723 WP_000122983.1.94725 WP_000122983.1.94740 WP_000122983.1.94816 WP_000122983.1.94826 WP_000122983.1.94900 WP_000122983.1.94948 WP_000122983.1.95001 WP_000122983.1.95026 WP_000122983.1.95040 WP_000122983.1.95092 WP_000122983.1.95109 WP_000122983.1.95111 WP_000122983.1.95172 WP_000122983.1.95260 WP_000122983.1.95269 WP_000122983.1.95270 WP_000122983.1.9536 WP_000122983.1.95363 WP_000122983.1.95498 WP_000122983.1.95503 WP_000122983.1.95539 WP_000122983.1.95599 WP_000122983.1.95622 WP_000122983.1.95653 WP_000122983.1.95665 WP_000122983.1.95755 WP_000122983.1.95844 WP_000122983.1.95859 WP_000122983.1.95873 WP_000122983.1.9593 WP_000122983.1.96029 WP_000122983.1.96046 WP_000122983.1.96119 WP_000122983.1.962 WP_000122983.1.9629 WP_000122983.1.96323 WP_000122983.1.96325 WP_000122983.1.9645 WP_000122983.1.96518 WP_000122983.1.96530 WP_000122983.1.96556 WP_000122983.1.96598 WP_000122983.1.96741 WP_000122983.1.96930 WP_000122983.1.96942 WP_000122983.1.96998 WP_000122983.1.97032 WP_000122983.1.9714 WP_000122983.1.97163 WP_000122983.1.97180 WP_000122983.1.97300 WP_000122983.1.9733 WP_000122983.1.97404 WP_000122983.1.97520 WP_000122983.1.97661 WP_000122983.1.97709 WP_000122983.1.97780 WP_000122983.1.97844 WP_000122983.1.97893 WP_000122983.1.97920 WP_000122983.1.9794 WP_000122983.1.98007 WP_000122983.1.98068 WP_000122983.1.982 WP_000122983.1.98272 WP_000122983.1.9832 WP_000122983.1.98321 WP_000122983.1.98369 WP_000122983.1.98434 WP_000122983.1.98561 WP_000122983.1.98625 WP_000122983.1.98691 WP_000122983.1.98769 WP_000122983.1.98806 WP_000122983.1.98835 WP_000122983.1.98919 WP_000122983.1.98950 WP_000122983.1.98965 WP_000122983.1.98968 WP_000122983.1.98986 WP_000122983.1.98998 WP_000122983.1.99041 WP_000122983.1.99048 WP_000122983.1.99049 WP_000122983.1.99077 WP_000122983.1.99162 WP_000122983.1.99188 WP_000122983.1.99250 WP_000122983.1.99391 WP_000122983.1.99420 WP_000122983.1.99429 WP_000122983.1.99449 WP_000122983.1.99464 WP_000122983.1.9952 WP_000122983.1.99555 WP_000122983.1.99653 WP_000122983.1.99665 WP_000122983.1.99770 WP_000122983.1.99775 WP_000122983.1.99806 WP_000122983.1.99833 WP_000122983.1.99964 gi|407934130|ref|YP_006849773.1| gi|385238976|ref|YP_005800315.1| gi|565637071|ref|YP_008889314.1| 405416.ACICU_03226 480119.AB57_3478 509173.ABAYE0461 557600.ABBFA_000488 HMPREF0010_02679T0 gi|523524696|ref|YP_008210775.1| gi|169794646|ref|YP_001712439.1| gi|215482235|ref|YP_002324417.1| gi|184159546|ref|YP_001847885.1| gi|523528562|ref|YP_008214593.1| gi|384144654|ref|YP_005527364.1| gi|384133236|ref|YP_005515848.1| gi|213157983|ref|YP_002320781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]