SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405440.Xfasm12_0516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405440.Xfasm12_0516
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily Translational machinery components 2.42e-45
Family Ribosomal protein L18 and S11 0.0000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405440.Xfasm12_0516
Sequence length 130
Comment (Xylella fastidiosa M12)
Sequence
MAKQSVVKTKKRVKRVITDGVAHICASFNNTIVTITDRQGNSLFWCTSGASGFRGSRKCT
PFAAQVAAEKAGRAVLDYGMKSLEVRINGPGPGRESAVRSLSNVGYKITNIIDVTPIPHN
GCRPPKKRRV
Download sequence
Identical sequences A0A1R2D9H0 B0U5M1 Q3RCK0
405440.Xfasm12_0516 2005389627 WP_004086543.1.28558 WP_004086543.1.34418 WP_004086543.1.34606 WP_004086543.1.35854 WP_004086543.1.45638 WP_004086543.1.46267 WP_004086543.1.530 WP_004086543.1.63667 gi|170729722|ref|YP_001775155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]