SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405531.BCG9842_B1339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  405531.BCG9842_B1339
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-50
Family Ribonuclease PH domain 1-like 0.000018
Further Details:      
 
Domain Number 2 Region: 293-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.24e-48
Family Ribonuclease PH domain 1-like 0.0000135
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.81e-30
Family Ribonuclease PH domain 2-like 0.0023
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.18e-28
Family Ribonuclease PH domain 2-like 0.0000977
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.93e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 
Domain Number 6 Region: 621-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.86e-22
Family Cold shock DNA-binding domain-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 405531.BCG9842_B1339
Sequence length 712
Comment (Bacillus cereus G9842)
Sequence
MSQEKQVFSIDLAGRQLTVETGQLAKQANGAVLVRYGDTAVLSTATASKEAKNVDFFPLT
VNYEERLYAVGKIPGGFIKREGRPSEKAILASRLIDRPIRPLFADGFRNEVQVVSIVMSV
DQDCSSEMAAMLGSSLALSISDIPFEGPIAGATVGRINGEFVINPTVEQQEQSDIHLVVA
GTKDAINMVEAGADQVPEETMLEAIMFGHDEIKRLIAFQEEIVQAVGKEKSEVKLYEVDA
DLNQAVREMAEKDMHSAIQVHEKHAREDAINEVKKRVIEHYEAEEADADTLGQVNEILYK
IVKEEVRRLITVEKIRPDGRKGDEIRPLASEVGILSRTHGSGLFTRGQTQALSICTLGAL
GDVQILDGLGVEESKRFMHHYNFPSFSVGETRPMRGPGRREIGHGALGERALEPVIPSEK
DFPYTVRLVSEVLESNGSTSQASICGSTLAMMDAGVPLKAPVAGIAMGLVKSGEHYTILS
DIQGMEDHLGDMDFKVAGTAQGVTALQMDIKIDGLSREILEEALQQAKIGRVHILNHMLS
VIAEPRTELSAYAPKIITMTINPDKIRDVIGPSGKQINKIIEETGVKIDIEQDGTVFISS
INQEMNDKAKKIIEDIVREVQVGEIYEGKVKRVEKFGAFVELFSGKDGLVHISELALERV
GKVEDVVKIGDVITVKVIEIDKQGRVNLSRKVLLKEEQEKEAAKEEDKQEQQ
Download sequence
Identical sequences A0A1H6Q149 A0A243M9Y9 A0A2H3Q9G1 B7IUG5 C3DNK8 J7HT93 J8CRN5 R8RS58
gi|402558867|ref|YP_006601591.1| gi|218898959|ref|YP_002447370.1| WP_000076744.1.22084 WP_000076744.1.27446 WP_000076744.1.35769 WP_000076744.1.36279 WP_000076744.1.4355 WP_000076744.1.48759 WP_000076744.1.50042 WP_000076744.1.61799 WP_000076744.1.6241 WP_000076744.1.70667 WP_000076744.1.73638 WP_000076744.1.83666 WP_000076744.1.87649 WP_000076744.1.92555 WP_000076744.1.9703 WP_000076744.1.98315 405531.BCG9842_B1339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]