SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 405534.BCAH187_A3117 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  405534.BCAH187_A3117
Domain Number - Region: 21-207
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 0.0262
Family Proton glutamate symport protein 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 405534.BCAH187_A3117
Sequence length 231
Comment (Bacillus cereus AH187)
Sequence
MVKLIGILLVAVGFLFRLNTLLVVMVAGIVTGMVSGLSFYDVISMFGKFFIENRYMSMPI
ILTLPVIGILERYGLKERAEALITKSKGATTGRVLISYFTIRESSAALGLNIGGHAQTVR
PLVAPMAEGAAQGKYGKLPEKLREKIKANAAAAENTAWFFGEDIFIATGAILLMKGFFDS
VGMHVGVWDMALWGIPTAISALIVSWIRFRRFDKYIAKTMTSKEKEEKEAI
Download sequence
Identical sequences A0A1Y6AZV8 B7HVU5
gi|217960504|ref|YP_002339066.1| WP_000239799.1.13299 405534.BCAH187_A3117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]