SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 406425.Bcenmc03_0384 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406425.Bcenmc03_0384
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily LigT-like 1.92e-34
Family 2'-5' RNA ligase LigT 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 406425.Bcenmc03_0384
Sequence length 194
Comment (Burkholderia cenocepacia MC0 3)
Sequence
MNGDRLRAFVALMPDAASRDALHALPVTRGARRTPSAQLHMTLAFIGAIERERCDALAAY
LPALAAAHALPSLPVERIAWWPSLPRARLIVAELAADAACVALNAGLAALLRELGVPADR
RPFRPHVTLARLPHDAIGQPAHGGAPGRPVEVRVEALTLFESRLSQEGVSHRPIVSAPIA
RADDSVGAEKRPHE
Download sequence
Identical sequences B1JU79
WP_012327772.1.90614 gi|170731739|ref|YP_001763686.1| 406425.Bcenmc03_0384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]