SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 406425.Bcenmc03_2277 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  406425.Bcenmc03_2277
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-51
Family Ribonuclease PH domain 1-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 300-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-50
Family Ribonuclease PH domain 1-like 0.0000175
Further Details:      
 
Domain Number 3 Region: 147-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-29
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 457-555
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.73e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 561-647
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.43e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 627-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.74e-21
Family Cold shock DNA-binding domain-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 406425.Bcenmc03_2277
Sequence length 715
Comment (Burkholderia cenocepacia MC0 3)
Sequence
MSMFNKVVKEFQWGQHKVRLETGEVARQASGAVIVDVEDTVVLATVVGAKSAKPGQDFFP
LTVDYLEKTYSAGKIPGGFFRREGRPSEHETLTSRLIDRPLRPLFPEGFYNEVQVVIHVL
SVNPEIPADIPALIGASAALAVSGLPFNGPVGAARVAYIDNAYVLNPTRDQLKASSLDLV
VAGTERAVLMVESEADQLSEEVMLGAVVFGHEQMQIAIDAIHELVRDGGKPEWDWQPAAK
NEALIARVTELAQNDLLAAYQLRDKQARSAKLKEVYAATSAKLEEDALAAGTVAADKATV
GNVLFDIEAKIVRSQILNGEPRIDGRDTRTVRPIEIRTGVLPRTHGSALFTRGETQALVV
ATLGTKGDEQIIDALEGEYRERFMLHYNMPPFATGETGRVGSPKRREIGHGRLAKRALVK
CLPSADEFGYSIRVVSEITESNGSSSMASVCGGCLALMDAGVPMKAHVAGIAMGLILEGN
KFAVLTDILGDEDHLGDMDFKVAGTEQGVTALQMDIKIQGITKEIMQVALAQAKEGRLHI
LGKMTSAVSGANTQLSEFAPRMITVKINPEKIRDVIGKGGSVIRALTEETGTTIDISDDG
VVTIASTSSEGMAEAKKRIEQITAEIEVGQVYEGTVLKLLDFGAIVNLLPGKDGLLHISE
IVNERVKDINDYLKEGQQVKVKVIQTDEKGRVRLSAKALLNEAAAAAQSDTPPQQ
Download sequence
Identical sequences B1JVP5
gi|170733613|ref|YP_001765560.1| 406425.Bcenmc03_2277 WP_012328908.1.90614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]