SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 407976.Sbal223_1010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  407976.Sbal223_1010
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily MAPEG domain-like 6.02e-25
Family MAPEG domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 407976.Sbal223_1010
Sequence length 127
Comment (Shewanella baltica OS223)
Sequence
MNTLLICLFVAMLLPYLAKGPVAWAMAKAGGYDNNHPRAQQAQLTGFGARALAGHQNAFE
SLLVFGLAVLVVIATGKVNPTAEWLAITHVAARFVYHILYLANKGTLRSLSWFVAIFSAF
GIFFQAF
Download sequence
Identical sequences A9L3E9 B8E4N9
gi|378707384|ref|YP_005272278.1| WP_006085871.1.35710 WP_006085871.1.60405 WP_006085871.1.74325 WP_006085871.1.76213 WP_006085871.1.93117 399599.Sbal195_1022 407976.Sbal223_1010 gi|160874142|ref|YP_001553458.1| gi|217972197|ref|YP_002356948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]