SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 407976.Sbal223_1133 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  407976.Sbal223_1133
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.81e-50
Family Ribonuclease PH domain 1-like 0.0000212
Further Details:      
 
Domain Number 2 Region: 298-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-46
Family Ribonuclease PH domain 1-like 0.0000197
Further Details:      
 
Domain Number 3 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.99e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.38e-27
Family Ribonuclease PH domain 2-like 0.00086
Further Details:      
 
Domain Number 5 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.11e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 
Domain Number 6 Region: 619-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.73e-21
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 7 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.23e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 407976.Sbal223_1133
Sequence length 699
Comment (Shewanella baltica OS223)
Sequence
MNPIVKSFEYGQHTVTLETGVIARQADAAVLASMGDTTVLVTVVGKKEADAGRDFFPLTV
NYQEKTYAAGKIPGGFFKREGRPSEDETLIARLIDRPIRPLFPNGFKNEVQVIITVVSVD
PQIEPDIISMIGTSAALAISGIPFSGPLGAARVGYIDGEYVLNPSVAQLATSQLNLVVAG
TAGAVLMVESEAQALPEEVMLGSVVYGHDQQQVVIKAIAEFKAEAGKPTWDWTAPTQDAD
LVAQIKELAEAGLGDAYKIQVKQDRYAQVSVVKAATKEALLASNPSIDLREVDNLLGSLE
KKVVRGRIIRGEPRIDGREPDMIRALSVLAGVLPRTHGSALFTRGETQALVTCTLGTERD
AQKIDSIMGERTNRFMLHYNFPPYSVGETGMVGSPKRREIGHGKLAWRGINAVMPSAAEF
PYSVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKTSVAGIAMGLVKEGDDFVVLSDI
LGDEDHLGDMDFKVAGTRDGITALQMDIKIEGITKEIMDIALQQAYGARVHILNVMDQAI
GSHRDDISDHAPRITVIKINPEKIRDVIGKGGAVIRALTEETGTTIELEDDGTVKIASSN
GEATKEAIRRIEEITSEVEVGRIYNGKVIRIVDFGAFVNILPGKDGLVHISQISDERVAN
VSDHLELNQEVAVKVMEVDRQGRVRLSIKEAQTKETAAE
Download sequence
Identical sequences B8E6N7
gi|217972320|ref|YP_002357071.1| 407976.Sbal223_1133 WP_012587034.1.74325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]