SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 407976.Sbal223_3559 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  407976.Sbal223_3559
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.75e-45
Family SMI1/KNR4-like 0.00000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 407976.Sbal223_3559
Sequence length 135
Comment (Shewanella baltica OS223)
Sequence
MHDIIEQLQERSETVPVPLELPTFEQLVEVEEQILISLPRELKEYLLYASDVIYGTIEPV
TASDPYSHTYLPEVTCYAWSIGMPRDMIAICQQGDAFYCIDQDGQVHFWKNGGFTDIYWE
SFWEWVEEIWLKIKY
Download sequence
Identical sequences A0A165JSW3 A3D0E8 B8E828
325240.Sbal_0683 402882.Shew185_3627 407976.Sbal223_3559 gi|386339733|ref|YP_006036099.1| WP_011845817.1.24904 WP_011845817.1.35710 WP_011845817.1.74325 WP_011845817.1.8014 WP_011845817.1.85636 WP_011845817.1.86146 gi|126172931|ref|YP_001049080.1| gi|153002134|ref|YP_001367815.1| gi|217974713|ref|YP_002359464.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]