SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 410358.Mlab_0827 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  410358.Mlab_0827
Domain Number - Region: 323-488
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00563
Family MRR-like 0.074
Further Details:      
 
Domain Number - Region: 167-220
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0367
Family Calponin-homology domain, CH-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 410358.Mlab_0827
Sequence length 574
Comment (Methanocorpusculum labreanum Z)
Sequence
MGLFARGIHDDETFGLTSDIAFDRAVFYGIPPEKMDLNCEKGRLLYILKDNVTKINSSKN
FSKSRHPLNDLKRNVLDIFANHLKENAYSNLPNPKNELYSYLIEGTVWLYFSNIVGRGIP
YAEASTPLRSANEKDVIREETPEWEEYIKSDEYGAKDTLIRGYCYSLEYLIDQLSPNLLD
TESLNYLHNIDNWNEINHIFDYLYKQIFINLDKIHENIWYISSFKNDKKLSKKSLSTIFD
KSIKLPKKSLKEQLDQIFLWYEVGFLDASAGPFSGMIALRTLLTGAVTKQKEREISEPIQ
IRIFKHQCFAGYNYSYAILMEGYGFAMDYSGWIVFFDTDTDYSGTSGHYHQLIDNDIQRY
KEYLNVVSFEVKKEKFEDYVMGIDAATQNGHSVTVIKRQDKEIERANQKVREIQNKLQRT
QDVLHSARGLIMELLTYYDLSRNPDTSKNLDWNIAQNKHEIDVTYVRNDDTVIFGECKVS
AKTTDLDGEMKNLVNKMKNWQPNVGNKMGHFFFFDELSETEVANYNKLKKKHSRGDVVIG
EYDVLSEKIYWDQNWKSKARDKLDYILKYNDKKI
Download sequence
Identical sequences A2SRP2
WP_011833199.1.86236 gi|124485649|ref|YP_001030265.1| 410358.Mlab_0827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]