SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412418.BRE_492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412418.BRE_492
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 6.93e-16
Family Ribosomal protein L29 (L29p) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 412418.BRE_492
Sequence length 66
Comment (Borrelia recurrentis A1)
Sequence
MLKNLKDLTLEDMKVKRLTLKKEYMDLRFKTVVGHVENPLKKRELRRDIARLNTIIHEYA
IGIRKV
Download sequence
Identical sequences B5RPJ0
gi|203287930|ref|YP_002222945.1| WP_012538937.1.6979 412418.BRE_492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]