SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412418.BRE_510 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412418.BRE_510
Domain Number 1 Region: 312-465
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.39e-28
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 191-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.91e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 412418.BRE_510
Sequence length 513
Comment (Borrelia recurrentis A1)
Sequence
MSYITFSSILAGVLGVILGFIIRIILGRFSLLNLDKKLKKVQEEAILEIENERKRVISHA
KSQMLKDKNQQDREIRERKNEVFNLEKRLLQREETLDKRIAALDKQQSRIDFKLKEFEQK
EKIIREKELSLVKKIENIAGLTKDEARKIVIEKVENESKRDAQIIINKSEQEAQLLADKV
AKDILVSTMQRIVTEVSSEFTVTSVELPNDEMKGRIIGKEGRNIRVLETLIGADIIIDDT
PEAVVISCFDPVRKEVAKRTLERLISDGRIHPARIEEIVYSVTNEINNIILEEGERAVFD
LNIHGFDKRLIRGLGRLYFRSSYGQNVLSHSKETAIIGEILAKEMKLDPVVVKRACLLHD
IGKGMESISENSEGHAITGAELAQSCGESDIVVNAIAAHHNEIKPESFEAIVVQIADAIS
ASRPGARRESLNNYITRLKRLEEIAYGFAGVQKCYAIQAGREVRIIVDNLLVNDEKATML
ARDIAKKIEVEMRYPGKIKVTIIRETRVIEYAR
Download sequence
Identical sequences B5RPK8
gi|203287948|ref|YP_002222963.1| 412418.BRE_510 WP_012538944.1.6979 WP_012538944.1.85550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]