SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412419.BDU_813 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412419.BDU_813
Domain Number 1 Region: 303-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-46
Family Ribonuclease PH domain 1-like 0.000012
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-44
Family Ribonuclease PH domain 1-like 0.0000561
Further Details:      
 
Domain Number 3 Region: 143-225
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.32e-26
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 450-545
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-25
Family Ribonuclease PH domain 2-like 0.00015
Further Details:      
 
Domain Number 5 Region: 555-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.3e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 6 Region: 228-327
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 9.16e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0049
Further Details:      
 
Domain Number 7 Region: 618-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000351
Family Cold shock DNA-binding domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 412419.BDU_813
Sequence length 717
Comment (Borrelia duttonii Ly)
Sequence
MRKILKLKIGREDLILETGLLAKQANGAVLATYGGSTVLATVCCSDSIRENLDFVPLSVE
YNEKYYAAGKIPGGFIKREGKPKDKEVLVSRLIDRPMRPLFDKRFGREIQVVPTTLSTDQ
MNPPDIVGMNAAFTAVFLSDIPFNGPIAAVRIAYLNDEFIVNPSFDEIQDSVLDIVVAGS
LDGITMVEGGANEVSEEILLDAIDKAYAYIKQICDLQKEFIYLIGEREKLPLAYEEKVFE
FKDDLRSLIYSELKDACFVRGKLNRDKAIKLVKQKAYEHFSSLEQINDENEILFYKACDD
FEQEIVRKSILEDNLRTDGRTPTQIRDIIAEVDLLKRTHGSALFTRGETQALAVTTLGTS
IDEQVMDDIDGDKRLNFMLHYNFPPFSVGETGRLMTGRREIGHGHLAQRSLEAMLPKKDD
FPYTIRVVSEVLESNGSSSMATVCSGSMSLMAAGVPVKEQVAGIAMGLISNDDKYVILSD
ILGEEDHLGDMDFKVAGTKNGITGFQMDIKISNVTKQLMRDALEQARIGRMHILSIMDSV
ISSSRGDISVNAPKIVQLQIDIDKISLVIGSTGKTVKAITDEFEVRVQIEQDGRITLFGT
DNLKMQKAKAKIESIVREPKVGEIYDGIVKKINSFGAFIELTPTKEGFLSNRSRSRDDRY
GSDIRHSRYSNRNSRYGRDNRSSFSMRFPRLEEGQIVKVRISDIDKFGKIELELARD
Download sequence
Identical sequences B5RMZ9
gi|203284701|ref|YP_002222441.1| 412419.BDU_813 WP_012538544.1.78452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]