SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 412965.COSY_0426 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  412965.COSY_0426
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-48
Family Ribonuclease PH domain 1-like 0.0000277
Further Details:      
 
Domain Number 2 Region: 292-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-45
Family Ribonuclease PH domain 1-like 0.0000272
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-28
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 4 Region: 452-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.91e-27
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 611-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-19
Family Cold shock DNA-binding domain-like 0.00051
Further Details:      
 
Domain Number 6 Region: 556-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000398
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 412965.COSY_0426
Sequence length 695
Comment (Candidatus Vesicomyosocius okutanii HA)
Sequence
MNIKTKSFTMGKHIVTLETGRIARQAHGAVLASMDDTQVLVTVVSSKETRPGQDFFPLSV
DYIEKTYSTGKIPGSFLKREARPSEKETLTSRLIDRTIRPLFPNGFMNEIQVLITVVSAN
SEVNPDIISMLGVSAALSISGVPFSRPIGGSRVGYSNGEYILNPTYIELTNSDLDMVVAG
TDEAVLMVESEANELSEEIMLGAVVYAHEQYQVAITNIAEFTTEVGMQKWDWIAPITNEV
LLSDIKSKFGKEINKAYQIKEKLDRHAKIDNIRMAAIEALENENENGNSAEEVSKYFKEV
EKSTVRERILNNDSRIDGRNNETVRELKIETGILKNTHGSALFTRGETQALVVTTLGPKS
DAQLIEKLESPERQNNYFLLHYNFPPYCVGETGRLATIKRREIGHGHLARRGITACLPSI
EEFPYTVRVVSEITESNGSSSMASVCGSSLSLMDAGVPIKAPIAGIAMGLVKENDRFTVL
TDILGDEDHLGDMDFKVAGTSRGVNALQMDIKIQSITHEIMEIALKQAKEARLNILGQMN
QVICEPNTSNKNTPKTTIIKIKTDKIRDLIGRGGETIKGIISTSCASIDVDDSGNVNIFS
NNQKSFDTAVQMVKDVTAIPEVNKVYTGKVVKIVEFGAFINIMPNQDGLLHISEISHERV
EKVKDHIREGDKIDVKVIGLDRGRIKLSRKVLLEK
Download sequence
Identical sequences A5CWW8
412965.COSY_0426 gi|148244575|ref|YP_001219269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]