SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 413404.Rmag_0461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413404.Rmag_0461
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-50
Family Ribonuclease PH domain 1-like 0.0000242
Further Details:      
 
Domain Number 2 Region: 291-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.62e-47
Family Ribonuclease PH domain 1-like 0.0000286
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.33e-28
Family Ribonuclease PH domain 2-like 0.00098
Further Details:      
 
Domain Number 4 Region: 452-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.01e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 610-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.5e-21
Family Cold shock DNA-binding domain-like 0.00045
Further Details:      
 
Domain Number 6 Region: 550-637
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000069
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 413404.Rmag_0461
Sequence length 695
Comment (Candidatus Ruthia magnifica Cm Calyptogena magnifica )
Sequence
MGINTKSFVMGKHTITLETGRIARQAHGAVLVSMDDTQVLVTVVGSKKMHPGQDFFPLSV
DYIEKTYAAGKIPGGFLKREARPSEKETLTSRLIDRPIRPLFPNGFMNEVQVLITVISAN
SEVDPDIISMLGVSAALSISGIPFNGPIGSARVGYSNGKYTLNPTYTELVDSDLDMVVAG
TDKAILMVESEASELSEKIILDAIIYAHEQYQVAITNIAEFVTQVGVQKWDWEAPATNEV
LLSNIKSQFGKQINEAYKIKEKLNRHVKVGEIKTAAIEALVNEDKNGNSIDEVSKYFNKV
EKSTVRERILNNDPRIDGRDNETVRELKIETGVLENTHGSALFTRGETQALVVTTLGSKR
EAQLIEKLESSERQNDYFLLHYNFPPYCVGEIGRVGTTKRREIGHGRLVRRGIAACLPSI
EEFPYTVRVVSEITESNGSSSMASICGASLSLMDAGVPIKAPVAGIAMGLVKEGDRFTIL
TDILGDEDHLGDMDFKVAGTSRGINALQMDIKIQGITREIMEIALKQAKEARLNILGQMN
QVICEPNTSNKNTPKTAVIKIQTDKIRDLIGKGGETIKGIISTSSASVDVDDNGNVNIFS
NDQKSFDTAMQMVKDVTTTPKIGKVYTGKVVKIVDFGAFINIKPNQDGLLHISEIAHERV
DKVENHLKEGDEIDVKVLSLDRGRIKLSRKVLLEK
Download sequence
Identical sequences A1AWB1
413404.Rmag_0461 WP_011737843.1.8199 WP_011737843.1.88829 gi|118602474|ref|YP_903689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]