SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 413502.Ctu_01870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413502.Ctu_01870
Domain Number 1 Region: 31-157
Classification Level Classification E-value
Superfamily PapD-like 1.18e-43
Family Pilus chaperone 0.00022
Further Details:      
 
Domain Number 2 Region: 159-238
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 3.27e-20
Family Periplasmic chaperone C-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 413502.Ctu_01870
Sequence length 241
Comment (Cronobacter turicensis)
Sequence
MYFLKGVNSMANTLSWKGAFFALATWFACPATIASIVITGTRVIYPSDAPEVSVKLDNKG
TSPVLIQSWIDNGNADAAPETIQVPFILTPPINRVEPDKGQTLRITFTGKLLPADRESVY
WLNVLEIPAKKASTVNDNYLQVAFRSRIKLFLRPKGLEGNANQAVTQVTWRANGQTIEAI
NPTPYFISLVNLKVNGKTINADMMSPKSTMTVKLSGSPGNKLAGVFVNDYGALNEFEATL
K
Download sequence
Identical sequences C9Y4Q2
gi|260595979|ref|YP_003208550.1| 413502.Ctu_01870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]