SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 413997.ECB_03031 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  413997.ECB_03031
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-50
Family Ribonuclease PH domain 1-like 0.0000141
Further Details:      
 
Domain Number 2 Region: 324-515
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.89e-46
Family Ribonuclease PH domain 1-like 0.0000178
Further Details:      
 
Domain Number 3 Region: 168-258
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-31
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 4 Region: 473-571
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.82e-27
Family Ribonuclease PH domain 2-like 0.0000875
Further Details:      
 
Domain Number 5 Region: 249-348
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.2e-25
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0012
Further Details:      
 
Domain Number 6 Region: 631-716
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.97e-23
Family Cold shock DNA-binding domain-like 0.0000219
Further Details:      
 
Domain Number 7 Region: 577-645
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 413997.ECB_03031
Sequence length 734
Comment (Escherichia coli B REL606)
Sequence
MRRRSGINTSAVRYCLRKRKDITLLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDD
TAVFVTVVGQKKAKPGQDFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDR
PIRPLFPEGFVNEVQVIATVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYI
NDQYVLNPTQDELKESKLDLVVAGTEAAVLMVESEAQLLSEDQMLGAVVFGHEQQQVVIQ
NINELVKEAGKPRWDWQPEPVNEALNARVAALAEARLSDAYRITDKQERYAQVDVIKSET
IATLLAEDETLDENELGEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRT
HGSALFTRGETQALVTATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPK
RREIGHGRLAKRGVLAVMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPI
KAAVAGIAMGLVKEGDNYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKE
IMQVALNQAKGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIR
ALTEETGTTIEIEDDGTVKIAATDGEKAKHAIRRIEEITAEIEVGRVYTGKVTRIVDFGA
FVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQ
PAAAPEAPAAEQGE
Download sequence
Identical sequences A0A077ZHU7 A0A0A0FG39 A0A0A0GD76 A0A1X3JCA3 E3PK76 F4SNP3 U9XXL7
gi|254163108|ref|YP_003046216.1| gi|387613856|ref|YP_006116972.1| gi|388479159|ref|YP_491351.1| gi|170082701|ref|YP_001732021.1| gi|471334726|ref|YP_007558203.1| 316385.ECDH10B_3337 316407.pnp 413997.ECB_03031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]