SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 413999.CBO2924 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  413999.CBO2924
Domain Number - Region: 64-102
Classification Level Classification E-value
Superfamily LigT-like 0.0487
Family 2'-5' RNA ligase LigT 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 413999.CBO2924
Sequence length 147
Comment (Clostridium botulinum A)
Sequence
MAYSDRELLARIIKCEAGGEGDNGMRAVATVVMNRVRVPYGEYHRIGQGNLRNVIYQPGQ
FDCVRDVLRGIPNPQTIWATPPEEIHYEIADWALSGNRLYNIGFSLWYFNPFQPSCPYTF
PANGSGSFQVRVVQHCFYNPTELYAQT
Download sequence
Identical sequences A0A175M7X0 A0A2I4NXH9 A5I606
WP_012047979.1.11430 WP_012047979.1.21778 WP_012047979.1.49536 WP_012047979.1.49637 WP_012047979.1.57120 WP_012047979.1.63111 WP_012047979.1.64959 WP_012047979.1.65765 WP_012047979.1.68124 WP_012047979.1.74799 YP_001255418.1.75347 YP_001388653.1.17653 gi|153930824|ref|YP_001385184.1| gi|148380877|ref|YP_001255418.1| gi|153935594|ref|YP_001388653.1| 413999.CBO2924 441770.CLB_2885 441771.CLC_2818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]