SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 41431.PCC8801_0807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41431.PCC8801_0807
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Globin-like 1e-55
Family Phycocyanin-like phycobilisome proteins 0.00000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 41431.PCC8801_0807
Sequence length 169
Comment (Cyanothece PCC 8801)
Sequence
MRDAVTNLIKNYDLTGRYLDRDAMDRLKDYFSSGMARITAAAVINANSPEIVRQAGLQLF
EEVPELIRPGGNAYTTRRYSACLRDMDYYLRYASYALVAGDSHVLDERVLQGLRETYNSL
GVPIGPTVRGIQIMKDMVKQMVADAGVDNTSFIDAPFDHLTREFSEISV
Download sequence
Identical sequences B7JYL9
gi|218245674|ref|YP_002371045.1| 395962.Cyan8802_0836 41431.PCC8801_0807 WP_012594165.1.62203 WP_012594165.1.93053 gi|257058721|ref|YP_003136609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]