SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 41431.PCC8801_1843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41431.PCC8801_1843
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-26
Family Anti-sigma factor antagonist SpoIIaa 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 41431.PCC8801_1843
Sequence length 104
Comment (Cyanothece PCC 8801)
Sequence
MLNIVRPSGVLDSTQGINFRKEINHLINNNATIIIVDFQNVTFMDSSGLGALVLSLKMAK
SHGTKLFLCSINDQIRMLLELTSMDKIFEIFPNLETLKQQISQS
Download sequence
Identical sequences B7JXS2
gi|218246671|ref|YP_002372042.1| gi|257059713|ref|YP_003137601.1| 395962.Cyan8802_1869 41431.PCC8801_1843 WP_012595158.1.62203 WP_012595158.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]