SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 416269.APL_0577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416269.APL_0577
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-49
Family Ribonuclease PH domain 1-like 0.0000126
Further Details:      
 
Domain Number 2 Region: 297-467
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-46
Family Ribonuclease PH domain 1-like 0.0000138
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.42e-30
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.98e-28
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 5 Region: 607-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-21
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 6 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.4e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0023
Further Details:      
 
Domain Number 7 Region: 551-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.8e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 416269.APL_0577
Sequence length 715
Comment (Actinobacillus pleuropneumoniae L20)
Sequence
MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVTVVAKKEVKEGQDFFPLTV
DYQERTYAAGRIPGGFFKREGRPSEGETLIARLIDRPVRPLFPEGFFNEIQVIATVVSVN
PQISPDLVAMIGASAALSLSGVPFNGPIGAARVGFINDQFVLNPTTSEQKISRLDLVVAG
TDKAVLMVESEADILSEEQMLSAVVFGHQQQQVVIENIKEFVKEAGKPRWDWVAPEPNTA
LINQVKALAEARIGDAYRITEKQARYEQIDAIKADVIAQLTAQDETVSEGAIIDIITALE
SSIVRGRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQALAVATLGTERD
AQIIDELTGEKSDRFLFHYNFPPYSVGETGRIGSPKRREIGHGRLAKRGVLAVMPTAEEF
PYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEEEKFVVLSDI
LGDEDHLGDMDFKVAGTREGVTALQMDIKIEGITPEIMQIALNQAKGARMHILSVMEQAI
PAPRADISDFAPRIHTMKIDPKKIKDVIGKGGAVIRALTEETGTSIDIDDDGTVKIAATD
NNAAKAVMARIEDIVAEVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVER
VADYLSVGQEVTVKVVEIDRQNRIRLTMKDLNNDTPVAENVTEEAEVSSEQQAEI
Download sequence
Identical sequences A3MZU3 B3GXC1 D9P428 E0F383 E0FFL8 E0FLN7
gi|126208059|ref|YP_001053284.1| WP_005600695.1.34241 WP_005600695.1.44215 WP_005600695.1.45850 WP_005600695.1.47094 WP_005600695.1.67471 WP_005600695.1.73473 WP_005600695.1.77337 WP_005600695.1.79691 WP_005600695.1.86265 416269.APL_0577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]