SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 416276.RMA_0669 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416276.RMA_0669
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-46
Family Ribonuclease PH domain 1-like 0.0000659
Further Details:      
 
Domain Number 2 Region: 300-469
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-42
Family Ribonuclease PH domain 1-like 0.0000274
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.4e-27
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 4 Region: 149-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.03e-25
Family Ribonuclease PH domain 2-like 0.0028
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.47e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 621-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.58e-18
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000243
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 416276.RMA_0669
Sequence length 745
Comment (Rickettsia massiliae MTU5)
Sequence
MFNEITKSVTWNGKVLELSTGKIARQADGAVTVKMGNSVLLCTVVVANKAKEGIGFFPLT
INYREMAYAAGKIPGGFFKREGKASDREVLVSRLIDRPIRPLFHPAFVNETHVTCSVLSY
DPEIPVDILAIIGASAALSLSPAPYLEMVAASKVGLINGEFVLNPTLELLKTSQLDLVVA
GTSDSVMMVESEAHLLSEEQMLEAVKFGFESFQPVIKIIKELAEEAKKPKLEMQDLYPAS
LKKEIEKLFVKEIEQAFAIKSKQERSTNLDLIPEKVLTHFVSDIENKKYSNYQIESALKA
IESDILRNEILEKNRRIDGRSTTDIRQIACEIGLLPSAHGSALFTRGETQSLVSTTFGTS
LDEQIVDSLEGEYKERFMLNYIFPPYSVNEAMPMKVPSRREVGHGKLAWRAINPILPNKV
QFPYSIRVVAETTESNGSSSMATVCGSSLALMYAGVPIKAPVAGIAMGLVKEGKKFAVLS
DILGDEDYFGDMDFKVAGTSEGITALQMDIKISGVDFKIMKVALEQARLGRLHILEQMNK
VISKPNNELSKNAPSTTTIKIDKDKIRDIIGPGGKVIKEICEISGAKIDISDDGTVSIYA
SDRDKLKVALDKIKAIAVEPEIGEIFNGTVMKVLDSGAFINYLGNKDGFVHISEISEERI
ETVSSVLKQGDIVKVKLIGFDNKGKAKLTIKNADKDKSSNNTKPKTNAKDNSEPEQRRDS
SKKRAWNEDNNAETAEVITERKYFN
Download sequence
Identical sequences A8F1P3
416276.RMA_0669 WP_012152804.1.73007 gi|157964552|ref|YP_001499376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]