SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 416348.Hlac_2661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416348.Hlac_2661
Domain Number 1 Region: 88-167
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000258
Family Eukaryotic type KH-domain (KH-domain type I) 0.00081
Further Details:      
 
Domain Number 2 Region: 2-73
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000449
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 416348.Hlac_2661
Sequence length 180
Comment (Halorubrum lacusprofundi ATCC 49239)
Sequence
MQHVTVPQDRIGVVIGAGGETMREIEERANVRLDIDSESGSVAIEELDDPVAALVAPDII
KAIGRGFKPETALSILDHDLRTLDLIDLSEHTRNDNDLQRKKGRIIGENGRTRELIEELS
GANVVVYGSTVGAVGQPEELEVVRRAVGMLLDGAPHGAVYSYLERMSNELDDDVSFNAPQ
Download sequence
Identical sequences B9LU38
WP_015911342.1.44229 WP_015911342.1.66911 WP_015911342.1.80915 gi|222481065|ref|YP_002567302.1| 416348.Hlac_2661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]