SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 416591.Tlet_1402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416591.Tlet_1402
Domain Number 1 Region: 299-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.71e-48
Family Ribonuclease PH domain 1-like 0.0000181
Further Details:      
 
Domain Number 2 Region: 5-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-45
Family Ribonuclease PH domain 1-like 0.0000301
Further Details:      
 
Domain Number 3 Region: 452-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.14e-26
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 135-227
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.68e-26
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 5 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 622-685
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000629
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 
Domain Number 7 Region: 227-328
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000127
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 416591.Tlet_1402
Sequence length 710
Comment (Thermotoga lettingae TMO)
Sequence
MKTWKREILGREFIVEHGKVAKQANGAVVARIGDTTVLATAVMSDSAVEGIDFVPLTVEF
QERFYAAGKIPGGFIKREGKPSEMAILSARTIDRPIRPLFPKHLRNEVQVVVTVISTDSV
NTPDIVGVFAASLALNISDIPFNGIVAAVRVGLVDGKIVLFPTEDQLQKSLLDIVVAGTE
DTITMVEGEAKEVSESQMLQALLKAHDAIKQIIDFEKEILSYFNIEKAQIAEKTLPEEIE
KEFSQLLDGNELRERLLIQGKKARSNALSEYFKKIYEILEARYGTEKIEELSVLLKDKYE
EALKYKMRRIIVEEGTRLDMRKPKDIRPITCETGLLPRVHGSALFTRGETQSLGIVTLGA
PMDEQIIDSLLEEGTKRFMLHYNFPPFSTGEVKPLRGPSRREIGHGHLAERALKFVLPDE
DRFPYTIRIVSEILESNGSSSMATVCSGSLALMDAGVPISKHVAGVAMGLILEKDSQIVL
TDILGAEDHWGDMDFKVAGTRDGITAFQMDCKVSGVSADLLERALNQAKEARLYVLEKLY
ETISKPRDTLSKYAPVIKVISIDPSKVAEIIGPGGKIIKALIKDYDVKISVDDLTGKVSV
IGGNEEKVDAAIEQINSILKEISVGDVFSGKVTRIEPFGVFVEISPGKVGLLHQSKLITD
LKTVKIGETMRVKVSNIDNLGRLQLEEFSDSPDHKHGEKRSFKRHRKNDN
Download sequence
Identical sequences A8F725
WP_012003435.1.46269 WP_012003435.1.88676 WP_012003435.1.90183 416591.Tlet_1402 gi|157364256|ref|YP_001471023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]