SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 416870.llmg_2156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416870.llmg_2156
Domain Number 1 Region: 336-474
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.23e-26
Family HD domain 0.028
Further Details:      
 
Domain Number 2 Region: 219-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.95e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 416870.llmg_2156
Sequence length 531
Comment (Lactococcus lactis cremoris MG1363)
Sequence
MDIISIVLLVLLVVLVVAFIFYAQNIKKNKQDAESLFNEAENKANEVMASAKREAESLKR
EAEAFKKEARYTLREEEQKQRREIEDEFKQERQELKETEKRLKQREEILDRKDDTLTKKE
ENLDSKEENLVRKTDTLSKREEQLAHIEEKKRLELERISNLSMDDAREIILSETRDGLTK
EMAQTIRQSEEKAQAEADKRAKNIISLAIQRVSSDSVAEQTVSVVNLPDDGMKGRIIGRE
GRNIRTFEALTGIDVIIDDTPEAVVLSGFDPIRREIARMTLEQLVQDGRIHPARIEELVE
KNRKALDHKMREYGEQAAFEVGAHNLHPDLMKIMGRLHFRTSYGQNVLDHSVEVAHIAGN
LAGEMGENEALAKRSGFLHDIGKALDHEVEGSHVEIGTELARKYKENPIVINTIASHHGD
TEPLSNIAVLVAAADALSAARPGARRESIENYIKRLKDLEAISTSFDGVETAFALQAGRE
IRVMVKPDKLTDDQIVILARDVKNRIEDEMDYPGNIKVTVIRETRAIDYAK
Download sequence
Identical sequences A0A165FM78 A2RN36
416870.llmg_2156 gi|389855303|ref|YP_006357547.1| gi|125624927|ref|YP_001033410.1| WP_011835860.1.100658 WP_011835860.1.31408 WP_011835860.1.33726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]