SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 418127.SAHV_1558 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  418127.SAHV_1558
Domain Number 1 Region: 53-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.99e-39
Family Tandem AAA-ATPase domain 0.063
Further Details:      
 
Domain Number 2 Region: 12-69
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000633
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 418127.SAHV_1558
Sequence length 315
Comment (Staphylococcus aureus Mu3)
Sequence
MPGIIQIDDMNQSQALIGNNDEHLKAIEESFDVVIHARGQEVAVKGTKIENVEKAESVLI
NLLKVIDLGNNITIKDVEAAIKMAHNNTIQHLLDLYDEEITKDAFGKTIRAKTMGQRIYV
NAMKNNDLVFGIGPAGTGKTFLAVVYAAKQLRKGAVKRIVLTRPAVEAGESLGFLPGDLK
EKVDPYLRPLYDGLYTVLGREQTERFIERGIIEIAPLAYMRGRTLEDAFVILDEAQNTTH
AQMKMFLTRLGFGSKMVVTGDQTQIDLPKGVKSGLKEAVSRLHNVKGISILKLDQSDVVR
HPLVSKIIEHYEGEN
Download sequence
Identical sequences A0A0D1J091 A0A0E1VJ23 A0A0H2XI11 A0A0H3JM48 A0A0H3JVL6 A0A0H3JWR6 A0A0H3KCZ9 A0A1E8X1T1 A0A2H5AP51 Q2FY01 W8UXD9
gi|15924561|ref|NP_372095.1| gi|386831181|ref|YP_006237835.1| gi|387780663|ref|YP_005755461.1| gi|379014779|ref|YP_005291015.1| WP_001117767.1.100013 WP_001117767.1.100041 WP_001117767.1.100049 WP_001117767.1.100057 WP_001117767.1.10006 WP_001117767.1.100067 WP_001117767.1.100072 WP_001117767.1.100075 WP_001117767.1.100084 WP_001117767.1.100088 WP_001117767.1.100094 WP_001117767.1.100096 WP_001117767.1.100117 WP_001117767.1.100122 WP_001117767.1.10014 WP_001117767.1.100154 WP_001117767.1.100171 WP_001117767.1.100180 WP_001117767.1.100184 WP_001117767.1.100189 WP_001117767.1.100235 WP_001117767.1.100265 WP_001117767.1.100272 WP_001117767.1.100298 WP_001117767.1.100307 WP_001117767.1.100310 WP_001117767.1.10032 WP_001117767.1.100335 WP_001117767.1.100347 WP_001117767.1.100357 WP_001117767.1.100366 WP_001117767.1.100391 WP_001117767.1.100399 WP_001117767.1.10041 WP_001117767.1.100452 WP_001117767.1.10046 WP_001117767.1.100464 WP_001117767.1.10050 WP_001117767.1.100507 WP_001117767.1.100527 WP_001117767.1.10053 WP_001117767.1.100534 WP_001117767.1.100535 WP_001117767.1.100551 WP_001117767.1.100560 WP_001117767.1.100562 WP_001117767.1.100582 WP_001117767.1.100596 WP_001117767.1.100604 WP_001117767.1.100612 WP_001117767.1.100613 WP_001117767.1.100618 WP_001117767.1.100631 WP_001117767.1.100647 WP_001117767.1.100665 WP_001117767.1.100668 WP_001117767.1.100678 WP_001117767.1.100693 WP_001117767.1.100699 WP_001117767.1.100704 WP_001117767.1.100719 WP_001117767.1.100726 WP_001117767.1.100761 WP_001117767.1.100768 WP_001117767.1.100785 WP_001117767.1.100823 WP_001117767.1.100832 WP_001117767.1.100834 WP_001117767.1.10085 WP_001117767.1.100860 WP_001117767.1.100888 WP_001117767.1.1009 WP_001117767.1.100903 WP_001117767.1.100920 WP_001117767.1.100922 WP_001117767.1.100934 WP_001117767.1.100956 WP_001117767.1.100963 WP_001117767.1.10097 WP_001117767.1.100981 WP_001117767.1.100986 WP_001117767.1.100987 WP_001117767.1.101002 WP_001117767.1.101017 WP_001117767.1.101019 WP_001117767.1.101023 WP_001117767.1.101027 WP_001117767.1.101055 WP_001117767.1.101058 WP_001117767.1.101068 WP_001117767.1.101071 WP_001117767.1.101072 WP_001117767.1.101084 WP_001117767.1.101103 WP_001117767.1.10111 WP_001117767.1.101142 WP_001117767.1.101160 WP_001117767.1.101177 WP_001117767.1.101192 WP_001117767.1.101217 WP_001117767.1.101240 WP_001117767.1.101262 WP_001117767.1.101266 WP_001117767.1.101298 WP_001117767.1.101327 WP_001117767.1.101329 WP_001117767.1.101330 WP_001117767.1.101352 WP_001117767.1.101355 WP_001117767.1.101375 WP_001117767.1.101379 WP_001117767.1.101393 WP_001117767.1.101397 WP_001117767.1.101402 WP_001117767.1.101406 WP_001117767.1.101414 WP_001117767.1.101440 WP_001117767.1.101441 WP_001117767.1.10148 WP_001117767.1.101490 WP_001117767.1.101495 WP_001117767.1.1015 WP_001117767.1.101505 WP_001117767.1.101511 WP_001117767.1.101531 WP_001117767.1.101566 WP_001117767.1.101567 WP_001117767.1.101570 WP_001117767.1.101598 WP_001117767.1.101615 WP_001117767.1.101617 WP_001117767.1.101619 WP_001117767.1.101627 WP_001117767.1.101645 WP_001117767.1.10165 WP_001117767.1.101657 WP_001117767.1.10166 WP_001117767.1.101661 WP_001117767.1.101670 WP_001117767.1.101691 WP_001117767.1.101704 WP_001117767.1.101716 WP_001117767.1.101725 WP_001117767.1.101728 WP_001117767.1.101731 WP_001117767.1.101745 WP_001117767.1.101778 WP_001117767.1.101779 WP_001117767.1.101788 WP_001117767.1.101813 WP_001117767.1.101820 WP_001117767.1.101821 WP_001117767.1.101824 WP_001117767.1.101825 WP_001117767.1.101831 WP_001117767.1.101852 WP_001117767.1.101902 WP_001117767.1.101906 WP_001117767.1.101921 WP_001117767.1.101950 WP_001117767.1.101999 WP_001117767.1.102064 WP_001117767.1.102065 WP_001117767.1.102066 WP_001117767.1.102070 WP_001117767.1.102084 WP_001117767.1.10209 WP_001117767.1.102096 WP_001117767.1.102123 WP_001117767.1.102126 WP_001117767.1.102130 WP_001117767.1.102132 WP_001117767.1.10214 WP_001117767.1.1022 WP_001117767.1.10232 WP_001117767.1.10238 WP_001117767.1.10240 WP_001117767.1.10244 WP_001117767.1.10249 WP_001117767.1.1025 WP_001117767.1.10274 WP_001117767.1.10292 WP_001117767.1.10294 WP_001117767.1.10301 WP_001117767.1.10306 WP_001117767.1.10308 WP_001117767.1.1031 WP_001117767.1.1032 WP_001117767.1.10321 WP_001117767.1.10343 WP_001117767.1.10355 WP_001117767.1.10358 WP_001117767.1.10397 WP_001117767.1.1043 WP_001117767.1.10431 WP_001117767.1.10436 WP_001117767.1.10450 WP_001117767.1.10469 WP_001117767.1.10478 WP_001117767.1.10481 WP_001117767.1.10503 WP_001117767.1.1052 WP_001117767.1.10526 WP_001117767.1.10542 WP_001117767.1.10543 WP_001117767.1.10565 WP_001117767.1.10583 WP_001117767.1.1060 WP_001117767.1.10614 WP_001117767.1.10617 WP_001117767.1.10624 WP_001117767.1.10644 WP_001117767.1.10664 WP_001117767.1.10679 WP_001117767.1.10707 WP_001117767.1.10726 WP_001117767.1.10742 WP_001117767.1.10749 WP_001117767.1.10751 WP_001117767.1.1077 WP_001117767.1.10783 WP_001117767.1.10785 WP_001117767.1.10823 WP_001117767.1.10841 WP_001117767.1.10843 WP_001117767.1.10858 WP_001117767.1.1087 WP_001117767.1.10917 WP_001117767.1.10919 WP_001117767.1.10928 WP_001117767.1.10942 WP_001117767.1.10950 WP_001117767.1.10965 WP_001117767.1.1097 WP_001117767.1.10976 WP_001117767.1.10979 WP_001117767.1.10985 WP_001117767.1.10986 WP_001117767.1.11001 WP_001117767.1.11067 WP_001117767.1.11069 WP_001117767.1.11073 WP_001117767.1.11074 WP_001117767.1.11083 WP_001117767.1.11084 WP_001117767.1.11129 WP_001117767.1.1115 WP_001117767.1.11162 WP_001117767.1.11184 WP_001117767.1.11188 WP_001117767.1.1120 WP_001117767.1.11202 WP_001117767.1.11220 WP_001117767.1.11223 WP_001117767.1.11228 WP_001117767.1.1124 WP_001117767.1.11261 WP_001117767.1.11281 WP_001117767.1.11282 WP_001117767.1.11286 WP_001117767.1.11287 WP_001117767.1.11294 WP_001117767.1.11312 WP_001117767.1.11322 WP_001117767.1.11333 WP_001117767.1.11348 WP_001117767.1.11353 WP_001117767.1.11365 WP_001117767.1.11377 WP_001117767.1.11378 WP_001117767.1.11391 WP_001117767.1.11403 WP_001117767.1.11407 WP_001117767.1.11434 WP_001117767.1.11441 WP_001117767.1.11447 WP_001117767.1.11451 WP_001117767.1.11463 WP_001117767.1.1147 WP_001117767.1.11475 WP_001117767.1.11488 WP_001117767.1.11492 WP_001117767.1.11494 WP_001117767.1.11504 WP_001117767.1.1151 WP_001117767.1.11513 WP_001117767.1.1152 WP_001117767.1.11525 WP_001117767.1.11540 WP_001117767.1.11556 WP_001117767.1.11558 WP_001117767.1.11571 WP_001117767.1.11580 WP_001117767.1.11592 WP_001117767.1.11611 WP_001117767.1.11625 WP_001117767.1.11640 WP_001117767.1.11646 WP_001117767.1.11655 WP_001117767.1.11660 WP_001117767.1.11663 WP_001117767.1.11665 WP_001117767.1.11692 WP_001117767.1.117 WP_001117767.1.1171 WP_001117767.1.11719 WP_001117767.1.11720 WP_001117767.1.11723 WP_001117767.1.11730 WP_001117767.1.11736 WP_001117767.1.11741 WP_001117767.1.11768 WP_001117767.1.11781 WP_001117767.1.11794 WP_001117767.1.11795 WP_001117767.1.11816 WP_001117767.1.11828 WP_001117767.1.11829 WP_001117767.1.11837 WP_001117767.1.11884 WP_001117767.1.11903 WP_001117767.1.11904 WP_001117767.1.11919 WP_001117767.1.11991 WP_001117767.1.12005 WP_001117767.1.12019 WP_001117767.1.12026 WP_001117767.1.12029 WP_001117767.1.12042 WP_001117767.1.1205 WP_001117767.1.12073 WP_001117767.1.12098 WP_001117767.1.1210 WP_001117767.1.12123 WP_001117767.1.1213 WP_001117767.1.12137 WP_001117767.1.12149 WP_001117767.1.12152 WP_001117767.1.12170 WP_001117767.1.12175 WP_001117767.1.12181 WP_001117767.1.12194 WP_001117767.1.12201 WP_001117767.1.12233 WP_001117767.1.12234 WP_001117767.1.12256 WP_001117767.1.12272 WP_001117767.1.12297 WP_001117767.1.12328 WP_001117767.1.12330 WP_001117767.1.12361 WP_001117767.1.12391 WP_001117767.1.12436 WP_001117767.1.12437 WP_001117767.1.12447 WP_001117767.1.12498 WP_001117767.1.12508 WP_001117767.1.12516 WP_001117767.1.1252 WP_001117767.1.1257 WP_001117767.1.12597 WP_001117767.1.12598 WP_001117767.1.12605 WP_001117767.1.12608 WP_001117767.1.12618 WP_001117767.1.12639 WP_001117767.1.12668 WP_001117767.1.12685 WP_001117767.1.12705 WP_001117767.1.12707 WP_001117767.1.12711 WP_001117767.1.12715 WP_001117767.1.12733 WP_001117767.1.12737 WP_001117767.1.1276 WP_001117767.1.12770 WP_001117767.1.12771 WP_001117767.1.12772 WP_001117767.1.12780 WP_001117767.1.12788 WP_001117767.1.12802 WP_001117767.1.12822 WP_001117767.1.12829 WP_001117767.1.12833 WP_001117767.1.12845 WP_001117767.1.12858 WP_001117767.1.12862 WP_001117767.1.12884 WP_001117767.1.12886 WP_001117767.1.12903 WP_001117767.1.12904 WP_001117767.1.12918 WP_001117767.1.12920 WP_001117767.1.12937 WP_001117767.1.12938 WP_001117767.1.12951 WP_001117767.1.12977 WP_001117767.1.13013 WP_001117767.1.13039 WP_001117767.1.13062 WP_001117767.1.13072 WP_001117767.1.13091 WP_001117767.1.13104 WP_001117767.1.13112 WP_001117767.1.13154 WP_001117767.1.13164 WP_001117767.1.13169 WP_001117767.1.13170 WP_001117767.1.13189 WP_001117767.1.13228 WP_001117767.1.13243 WP_001117767.1.13250 WP_001117767.1.13303 WP_001117767.1.13317 WP_001117767.1.13322 WP_001117767.1.13326 WP_001117767.1.13336 WP_001117767.1.13355 WP_001117767.1.13366 WP_001117767.1.13376 WP_001117767.1.13379 WP_001117767.1.13381 WP_001117767.1.13405 WP_001117767.1.13448 WP_001117767.1.13468 WP_001117767.1.1347 WP_001117767.1.13486 WP_001117767.1.13501 WP_001117767.1.13514 WP_001117767.1.13531 WP_001117767.1.13532 WP_001117767.1.13554 WP_001117767.1.13556 WP_001117767.1.13557 WP_001117767.1.13568 WP_001117767.1.13598 WP_001117767.1.13612 WP_001117767.1.13617 WP_001117767.1.13654 WP_001117767.1.13665 WP_001117767.1.13668 WP_001117767.1.13670 WP_001117767.1.13679 WP_001117767.1.13680 WP_001117767.1.13683 WP_001117767.1.13696 WP_001117767.1.13727 WP_001117767.1.13728 WP_001117767.1.13733 WP_001117767.1.13734 WP_001117767.1.1374 WP_001117767.1.1375 WP_001117767.1.13755 WP_001117767.1.13757 WP_001117767.1.13769 WP_001117767.1.13772 WP_001117767.1.13787 WP_001117767.1.13804 WP_001117767.1.13805 WP_001117767.1.13831 WP_001117767.1.13870 WP_001117767.1.13879 WP_001117767.1.13884 WP_001117767.1.13897 WP_001117767.1.13904 WP_001117767.1.13914 WP_001117767.1.13933 WP_001117767.1.13940 WP_001117767.1.13947 WP_001117767.1.13948 WP_001117767.1.13983 WP_001117767.1.13986 WP_001117767.1.13987 WP_001117767.1.14010 WP_001117767.1.14025 WP_001117767.1.14034 WP_001117767.1.14071 WP_001117767.1.14076 WP_001117767.1.14097 WP_001117767.1.14112 WP_001117767.1.14143 WP_001117767.1.14153 WP_001117767.1.14163 WP_001117767.1.1418 WP_001117767.1.14192 WP_001117767.1.1420 WP_001117767.1.14201 WP_001117767.1.14233 WP_001117767.1.1425 WP_001117767.1.1426 WP_001117767.1.1429 WP_001117767.1.14298 WP_001117767.1.14302 WP_001117767.1.14305 WP_001117767.1.14337 WP_001117767.1.14342 WP_001117767.1.14349 WP_001117767.1.14355 WP_001117767.1.14358 WP_001117767.1.14363 WP_001117767.1.14364 WP_001117767.1.14366 WP_001117767.1.14372 WP_001117767.1.14394 WP_001117767.1.14397 WP_001117767.1.14412 WP_001117767.1.14418 WP_001117767.1.14475 WP_001117767.1.14535 WP_001117767.1.14546 WP_001117767.1.1457 WP_001117767.1.14577 WP_001117767.1.14590 WP_001117767.1.14596 WP_001117767.1.14639 WP_001117767.1.14665 WP_001117767.1.14666 WP_001117767.1.1468 WP_001117767.1.14681 WP_001117767.1.147 WP_001117767.1.1471 WP_001117767.1.14729 WP_001117767.1.14734 WP_001117767.1.14744 WP_001117767.1.14747 WP_001117767.1.1477 WP_001117767.1.14770 WP_001117767.1.14774 WP_001117767.1.14782 WP_001117767.1.14787 WP_001117767.1.14790 WP_001117767.1.14809 WP_001117767.1.14823 WP_001117767.1.14825 WP_001117767.1.14846 WP_001117767.1.14866 WP_001117767.1.14868 WP_001117767.1.14869 WP_001117767.1.14874 WP_001117767.1.14888 WP_001117767.1.1490 WP_001117767.1.14902 WP_001117767.1.14924 WP_001117767.1.14967 WP_001117767.1.14970 WP_001117767.1.14987 WP_001117767.1.15000 WP_001117767.1.15015 WP_001117767.1.15022 WP_001117767.1.15029 WP_001117767.1.15039 WP_001117767.1.15071 WP_001117767.1.15091 WP_001117767.1.15108 WP_001117767.1.15150 WP_001117767.1.15173 WP_001117767.1.15182 WP_001117767.1.15185 WP_001117767.1.1520 WP_001117767.1.15201 WP_001117767.1.15206 WP_001117767.1.15234 WP_001117767.1.15241 WP_001117767.1.1525 WP_001117767.1.15255 WP_001117767.1.15263 WP_001117767.1.15268 WP_001117767.1.15269 WP_001117767.1.15278 WP_001117767.1.15294 WP_001117767.1.15296 WP_001117767.1.15389 WP_001117767.1.15399 WP_001117767.1.15403 WP_001117767.1.15409 WP_001117767.1.15421 WP_001117767.1.15438 WP_001117767.1.1545 WP_001117767.1.15478 WP_001117767.1.15489 WP_001117767.1.15505 WP_001117767.1.15507 WP_001117767.1.15519 WP_001117767.1.15524 WP_001117767.1.15532 WP_001117767.1.15533 WP_001117767.1.15544 WP_001117767.1.15546 WP_001117767.1.15554 WP_001117767.1.15572 WP_001117767.1.1558 WP_001117767.1.15590 WP_001117767.1.15591 WP_001117767.1.1562 WP_001117767.1.1564 WP_001117767.1.15679 WP_001117767.1.15687 WP_001117767.1.1569 WP_001117767.1.15691 WP_001117767.1.15706 WP_001117767.1.15722 WP_001117767.1.15753 WP_001117767.1.15785 WP_001117767.1.1579 WP_001117767.1.15812 WP_001117767.1.15818 WP_001117767.1.15819 WP_001117767.1.1583 WP_001117767.1.15838 WP_001117767.1.1586 WP_001117767.1.15883 WP_001117767.1.15888 WP_001117767.1.15892 WP_001117767.1.15897 WP_001117767.1.15898 WP_001117767.1.159 WP_001117767.1.15920 WP_001117767.1.15921 WP_001117767.1.15925 WP_001117767.1.15928 WP_001117767.1.15939 WP_001117767.1.15948 WP_001117767.1.15957 WP_001117767.1.15972 WP_001117767.1.1599 WP_001117767.1.1600 WP_001117767.1.16018 WP_001117767.1.1606 WP_001117767.1.16068 WP_001117767.1.16095 WP_001117767.1.16096 WP_001117767.1.16098 WP_001117767.1.16112 WP_001117767.1.16114 WP_001117767.1.16140 WP_001117767.1.16157 WP_001117767.1.16173 WP_001117767.1.16195 WP_001117767.1.16203 WP_001117767.1.16213 WP_001117767.1.16223 WP_001117767.1.1623 WP_001117767.1.16237 WP_001117767.1.16251 WP_001117767.1.16265 WP_001117767.1.16276 WP_001117767.1.16283 WP_001117767.1.16311 WP_001117767.1.16362 WP_001117767.1.16372 WP_001117767.1.16395 WP_001117767.1.16399 WP_001117767.1.16407 WP_001117767.1.16417 WP_001117767.1.16433 WP_001117767.1.16436 WP_001117767.1.16455 WP_001117767.1.16458 WP_001117767.1.16467 WP_001117767.1.16478 WP_001117767.1.16554 WP_001117767.1.16569 WP_001117767.1.16589 WP_001117767.1.16603 WP_001117767.1.16606 WP_001117767.1.16617 WP_001117767.1.1662 WP_001117767.1.16628 WP_001117767.1.16632 WP_001117767.1.16639 WP_001117767.1.16649 WP_001117767.1.1665 WP_001117767.1.16651 WP_001117767.1.16653 WP_001117767.1.16664 WP_001117767.1.16672 WP_001117767.1.16684 WP_001117767.1.16688 WP_001117767.1.16693 WP_001117767.1.16703 WP_001117767.1.16747 WP_001117767.1.16761 WP_001117767.1.16762 WP_001117767.1.16768 WP_001117767.1.16770 WP_001117767.1.16776 WP_001117767.1.16794 WP_001117767.1.16815 WP_001117767.1.16824 WP_001117767.1.16833 WP_001117767.1.16880 WP_001117767.1.16882 WP_001117767.1.16892 WP_001117767.1.16920 WP_001117767.1.16925 WP_001117767.1.16936 WP_001117767.1.16938 WP_001117767.1.16946 WP_001117767.1.16969 WP_001117767.1.16986 WP_001117767.1.170 WP_001117767.1.17009 WP_001117767.1.17012 WP_001117767.1.17038 WP_001117767.1.17046 WP_001117767.1.17050 WP_001117767.1.17080 WP_001117767.1.17104 WP_001117767.1.17122 WP_001117767.1.17132 WP_001117767.1.17137 WP_001117767.1.17139 WP_001117767.1.17143 WP_001117767.1.17156 WP_001117767.1.17157 WP_001117767.1.17169 WP_001117767.1.17176 WP_001117767.1.17180 WP_001117767.1.17193 WP_001117767.1.17200 WP_001117767.1.17201 WP_001117767.1.17210 WP_001117767.1.17231 WP_001117767.1.17234 WP_001117767.1.17240 WP_001117767.1.17248 WP_001117767.1.17249 WP_001117767.1.1725 WP_001117767.1.17256 WP_001117767.1.17289 WP_001117767.1.1729 WP_001117767.1.17309 WP_001117767.1.17320 WP_001117767.1.17327 WP_001117767.1.1736 WP_001117767.1.1740 WP_001117767.1.1741 WP_001117767.1.17419 WP_001117767.1.17450 WP_001117767.1.17454 WP_001117767.1.17456 WP_001117767.1.17475 WP_001117767.1.17485 WP_001117767.1.17526 WP_001117767.1.17529 WP_001117767.1.17531 WP_001117767.1.1756 WP_001117767.1.17569 WP_001117767.1.17581 WP_001117767.1.17590 WP_001117767.1.17628 WP_001117767.1.17643 WP_001117767.1.1765 WP_001117767.1.17651 WP_001117767.1.17657 WP_001117767.1.17658 WP_001117767.1.17666 WP_001117767.1.17671 WP_001117767.1.17676 WP_001117767.1.1771 WP_001117767.1.17717 WP_001117767.1.17718 WP_001117767.1.17720 WP_001117767.1.17725 WP_001117767.1.17737 WP_001117767.1.17770 WP_001117767.1.17796 WP_001117767.1.17818 WP_001117767.1.17832 WP_001117767.1.17834 WP_001117767.1.17835 WP_001117767.1.17838 WP_001117767.1.17845 WP_001117767.1.17847 WP_001117767.1.17853 WP_001117767.1.17859 WP_001117767.1.1787 WP_001117767.1.17876 WP_001117767.1.17882 WP_001117767.1.17909 WP_001117767.1.17922 WP_001117767.1.17928 WP_001117767.1.17929 WP_001117767.1.17943 WP_001117767.1.17951 WP_001117767.1.17966 WP_001117767.1.17974 WP_001117767.1.17987 WP_001117767.1.18011 WP_001117767.1.18016 WP_001117767.1.18035 WP_001117767.1.18043 WP_001117767.1.18069 WP_001117767.1.18074 WP_001117767.1.18080 WP_001117767.1.18105 WP_001117767.1.18113 WP_001117767.1.18140 WP_001117767.1.18153 WP_001117767.1.18203 WP_001117767.1.18205 WP_001117767.1.18237 WP_001117767.1.18248 WP_001117767.1.18261 WP_001117767.1.18283 WP_001117767.1.18288 WP_001117767.1.1829 WP_001117767.1.18290 WP_001117767.1.18301 WP_001117767.1.18309 WP_001117767.1.18310 WP_001117767.1.18320 WP_001117767.1.18346 WP_001117767.1.1835 WP_001117767.1.18360 WP_001117767.1.18412 WP_001117767.1.18429 WP_001117767.1.18437 WP_001117767.1.18451 WP_001117767.1.18466 WP_001117767.1.1847 WP_001117767.1.18487 WP_001117767.1.18495 WP_001117767.1.18497 WP_001117767.1.185 WP_001117767.1.18504 WP_001117767.1.18507 WP_001117767.1.1851 WP_001117767.1.18516 WP_001117767.1.18527 WP_001117767.1.18529 WP_001117767.1.18539 WP_001117767.1.18545 WP_001117767.1.18560 WP_001117767.1.18562 WP_001117767.1.18566 WP_001117767.1.18570 WP_001117767.1.18590 WP_001117767.1.18591 WP_001117767.1.18611 WP_001117767.1.18632 WP_001117767.1.18656 WP_001117767.1.18658 WP_001117767.1.18668 WP_001117767.1.18679 WP_001117767.1.18719 WP_001117767.1.18741 WP_001117767.1.18758 WP_001117767.1.18763 WP_001117767.1.18774 WP_001117767.1.18777 WP_001117767.1.18779 WP_001117767.1.18792 WP_001117767.1.18809 WP_001117767.1.18818 WP_001117767.1.18819 WP_001117767.1.18830 WP_001117767.1.18834 WP_001117767.1.18836 WP_001117767.1.18879 WP_001117767.1.18882 WP_001117767.1.18918 WP_001117767.1.1892 WP_001117767.1.18938 WP_001117767.1.18963 WP_001117767.1.18965 WP_001117767.1.18968 WP_001117767.1.18974 WP_001117767.1.18987 WP_001117767.1.18996 WP_001117767.1.19009 WP_001117767.1.1901 WP_001117767.1.19014 WP_001117767.1.19022 WP_001117767.1.19027 WP_001117767.1.19052 WP_001117767.1.19082 WP_001117767.1.19102 WP_001117767.1.19109 WP_001117767.1.1911 WP_001117767.1.19149 WP_001117767.1.19179 WP_001117767.1.192 WP_001117767.1.1921 WP_001117767.1.19259 WP_001117767.1.19272 WP_001117767.1.19301 WP_001117767.1.19306 WP_001117767.1.19322 WP_001117767.1.19365 WP_001117767.1.19375 WP_001117767.1.19377 WP_001117767.1.19386 WP_001117767.1.19399 WP_001117767.1.1940 WP_001117767.1.19411 WP_001117767.1.1943 WP_001117767.1.19430 WP_001117767.1.19444 WP_001117767.1.19450 WP_001117767.1.19455 WP_001117767.1.19497 WP_001117767.1.19509 WP_001117767.1.19515 WP_001117767.1.19537 WP_001117767.1.19555 WP_001117767.1.19575 WP_001117767.1.19577 WP_001117767.1.19611 WP_001117767.1.1962 WP_001117767.1.1964 WP_001117767.1.19643 WP_001117767.1.19653 WP_001117767.1.19700 WP_001117767.1.19701 WP_001117767.1.19717 WP_001117767.1.19725 WP_001117767.1.19732 WP_001117767.1.19733 WP_001117767.1.1974 WP_001117767.1.19748 WP_001117767.1.1975 WP_001117767.1.19759 WP_001117767.1.19765 WP_001117767.1.19775 WP_001117767.1.19788 WP_001117767.1.19792 WP_001117767.1.19801 WP_001117767.1.19816 WP_001117767.1.19848 WP_001117767.1.19881 WP_001117767.1.19891 WP_001117767.1.19904 WP_001117767.1.19905 WP_001117767.1.19912 WP_001117767.1.19921 WP_001117767.1.19968 WP_001117767.1.19977 WP_001117767.1.19980 WP_001117767.1.19981 WP_001117767.1.19982 WP_001117767.1.2 WP_001117767.1.20006 WP_001117767.1.20049 WP_001117767.1.20052 WP_001117767.1.20057 WP_001117767.1.2007 WP_001117767.1.20078 WP_001117767.1.2008 WP_001117767.1.20090 WP_001117767.1.20100 WP_001117767.1.20101 WP_001117767.1.2013 WP_001117767.1.20155 WP_001117767.1.20156 WP_001117767.1.20160 WP_001117767.1.20161 WP_001117767.1.20167 WP_001117767.1.20177 WP_001117767.1.20191 WP_001117767.1.20210 WP_001117767.1.20214 WP_001117767.1.20219 WP_001117767.1.20221 WP_001117767.1.20235 WP_001117767.1.20245 WP_001117767.1.2025 WP_001117767.1.2029 WP_001117767.1.20324 WP_001117767.1.20340 WP_001117767.1.20358 WP_001117767.1.20386 WP_001117767.1.20394 WP_001117767.1.20398 WP_001117767.1.20399 WP_001117767.1.20411 WP_001117767.1.20447 WP_001117767.1.20473 WP_001117767.1.20479 WP_001117767.1.20487 WP_001117767.1.20512 WP_001117767.1.20554 WP_001117767.1.20558 WP_001117767.1.2056 WP_001117767.1.20574 WP_001117767.1.20579 WP_001117767.1.20585 WP_001117767.1.20598 WP_001117767.1.20611 WP_001117767.1.20618 WP_001117767.1.20619 WP_001117767.1.20620 WP_001117767.1.20649 WP_001117767.1.20661 WP_001117767.1.20690 WP_001117767.1.20698 WP_001117767.1.20736 WP_001117767.1.20772 WP_001117767.1.20796 WP_001117767.1.20821 WP_001117767.1.20833 WP_001117767.1.20838 WP_001117767.1.20846 WP_001117767.1.20860 WP_001117767.1.20866 WP_001117767.1.20867 WP_001117767.1.20878 WP_001117767.1.20906 WP_001117767.1.20913 WP_001117767.1.20922 WP_001117767.1.20935 WP_001117767.1.20939 WP_001117767.1.20945 WP_001117767.1.20971 WP_001117767.1.20975 WP_001117767.1.20979 WP_001117767.1.21009 WP_001117767.1.21013 WP_001117767.1.21015 WP_001117767.1.21031 WP_001117767.1.21036 WP_001117767.1.21054 WP_001117767.1.21056 WP_001117767.1.21064 WP_001117767.1.21066 WP_001117767.1.21078 WP_001117767.1.21080 WP_001117767.1.21102 WP_001117767.1.21109 WP_001117767.1.21111 WP_001117767.1.21140 WP_001117767.1.21183 WP_001117767.1.2119 WP_001117767.1.21222 WP_001117767.1.21257 WP_001117767.1.21259 WP_001117767.1.21272 WP_001117767.1.2128 WP_001117767.1.2129 WP_001117767.1.21312 WP_001117767.1.21313 WP_001117767.1.21314 WP_001117767.1.21330 WP_001117767.1.21339 WP_001117767.1.2135 WP_001117767.1.21356 WP_001117767.1.21359 WP_001117767.1.21375 WP_001117767.1.21379 WP_001117767.1.21386 WP_001117767.1.21393 WP_001117767.1.21402 WP_001117767.1.21416 WP_001117767.1.21449 WP_001117767.1.21458 WP_001117767.1.21464 WP_001117767.1.21465 WP_001117767.1.21480 WP_001117767.1.21500 WP_001117767.1.21505 WP_001117767.1.21511 WP_001117767.1.21514 WP_001117767.1.2154 WP_001117767.1.21572 WP_001117767.1.21583 WP_001117767.1.21589 WP_001117767.1.2159 WP_001117767.1.2160 WP_001117767.1.21601 WP_001117767.1.21621 WP_001117767.1.21636 WP_001117767.1.21679 WP_001117767.1.21712 WP_001117767.1.21719 WP_001117767.1.21724 WP_001117767.1.21746 WP_001117767.1.21763 WP_001117767.1.21787 WP_001117767.1.21820 WP_001117767.1.21828 WP_001117767.1.21830 WP_001117767.1.21890 WP_001117767.1.21894 WP_001117767.1.21900 WP_001117767.1.21901 WP_001117767.1.21954 WP_001117767.1.21985 WP_001117767.1.21988 WP_001117767.1.2200 WP_001117767.1.22000 WP_001117767.1.22011 WP_001117767.1.22022 WP_001117767.1.22027 WP_001117767.1.22033 WP_001117767.1.22038 WP_001117767.1.22045 WP_001117767.1.22049 WP_001117767.1.22065 WP_001117767.1.22082 WP_001117767.1.22093 WP_001117767.1.2211 WP_001117767.1.22111 WP_001117767.1.22163 WP_001117767.1.22164 WP_001117767.1.22165 WP_001117767.1.22170 WP_001117767.1.22174 WP_001117767.1.22177 WP_001117767.1.22180 WP_001117767.1.22197 WP_001117767.1.22200 WP_001117767.1.22227 WP_001117767.1.22246 WP_001117767.1.22259 WP_001117767.1.22302 WP_001117767.1.22307 WP_001117767.1.22344 WP_001117767.1.22367 WP_001117767.1.22369 WP_001117767.1.22400 WP_001117767.1.22418 WP_001117767.1.22419 WP_001117767.1.22426 WP_001117767.1.22441 WP_001117767.1.22493 WP_001117767.1.22498 WP_001117767.1.22526 WP_001117767.1.22531 WP_001117767.1.22533 WP_001117767.1.22547 WP_001117767.1.22551 WP_001117767.1.22559 WP_001117767.1.22650 WP_001117767.1.22657 WP_001117767.1.22696 WP_001117767.1.22702 WP_001117767.1.22714 WP_001117767.1.22727 WP_001117767.1.22731 WP_001117767.1.22738 WP_001117767.1.22739 WP_001117767.1.22764 WP_001117767.1.22789 WP_001117767.1.22790 WP_001117767.1.22792 WP_001117767.1.2280 WP_001117767.1.22803 WP_001117767.1.22808 WP_001117767.1.22811 WP_001117767.1.22826 WP_001117767.1.22843 WP_001117767.1.22853 WP_001117767.1.22859 WP_001117767.1.22861 WP_001117767.1.22869 WP_001117767.1.22890 WP_001117767.1.22924 WP_001117767.1.22969 WP_001117767.1.22975 WP_001117767.1.22983 WP_001117767.1.22984 WP_001117767.1.22994 WP_001117767.1.23004 WP_001117767.1.23008 WP_001117767.1.23012 WP_001117767.1.23048 WP_001117767.1.23061 WP_001117767.1.23069 WP_001117767.1.23082 WP_001117767.1.23103 WP_001117767.1.23121 WP_001117767.1.23130 WP_001117767.1.23132 WP_001117767.1.23133 WP_001117767.1.23146 WP_001117767.1.23152 WP_001117767.1.23161 WP_001117767.1.23185 WP_001117767.1.23194 WP_001117767.1.23197 WP_001117767.1.23217 WP_001117767.1.23222 WP_001117767.1.23228 WP_001117767.1.23238 WP_001117767.1.23244 WP_001117767.1.23251 WP_001117767.1.2327 WP_001117767.1.23275 WP_001117767.1.23288 WP_001117767.1.23304 WP_001117767.1.23381 WP_001117767.1.23413 WP_001117767.1.23420 WP_001117767.1.23431 WP_001117767.1.23439 WP_001117767.1.23449 WP_001117767.1.23450 WP_001117767.1.23476 WP_001117767.1.23491 WP_001117767.1.23516 WP_001117767.1.23517 WP_001117767.1.23531 WP_001117767.1.23541 WP_001117767.1.23544 WP_001117767.1.23557 WP_001117767.1.23568 WP_001117767.1.23572 WP_001117767.1.23580 WP_001117767.1.23586 WP_001117767.1.23613 WP_001117767.1.23617 WP_001117767.1.23630 WP_001117767.1.23644 WP_001117767.1.23671 WP_001117767.1.23690 WP_001117767.1.23708 WP_001117767.1.23710 WP_001117767.1.23730 WP_001117767.1.23740 WP_001117767.1.23796 WP_001117767.1.23809 WP_001117767.1.2382 WP_001117767.1.23822 WP_001117767.1.23842 WP_001117767.1.23849 WP_001117767.1.23856 WP_001117767.1.2389 WP_001117767.1.23896 WP_001117767.1.23900 WP_001117767.1.23902 WP_001117767.1.23926 WP_001117767.1.23935 WP_001117767.1.23944 WP_001117767.1.23956 WP_001117767.1.23972 WP_001117767.1.23995 WP_001117767.1.23998 WP_001117767.1.24000 WP_001117767.1.24081 WP_001117767.1.24129 WP_001117767.1.24148 WP_001117767.1.24154 WP_001117767.1.24167 WP_001117767.1.24174 WP_001117767.1.2420 WP_001117767.1.24207 WP_001117767.1.24213 WP_001117767.1.24226 WP_001117767.1.2423 WP_001117767.1.24241 WP_001117767.1.24263 WP_001117767.1.2427 WP_001117767.1.24275 WP_001117767.1.24276 WP_001117767.1.24277 WP_001117767.1.24279 WP_001117767.1.24286 WP_001117767.1.24302 WP_001117767.1.2434 WP_001117767.1.24343 WP_001117767.1.24364 WP_001117767.1.24365 WP_001117767.1.24416 WP_001117767.1.24418 WP_001117767.1.2442 WP_001117767.1.24436 WP_001117767.1.24437 WP_001117767.1.24439 WP_001117767.1.24443 WP_001117767.1.24462 WP_001117767.1.24469 WP_001117767.1.24478 WP_001117767.1.2450 WP_001117767.1.24503 WP_001117767.1.24516 WP_001117767.1.24519 WP_001117767.1.24569 WP_001117767.1.24572 WP_001117767.1.24589 WP_001117767.1.24596 WP_001117767.1.24602 WP_001117767.1.24625 WP_001117767.1.24631 WP_001117767.1.24654 WP_001117767.1.24674 WP_001117767.1.24679 WP_001117767.1.24681 WP_001117767.1.24684 WP_001117767.1.24685 WP_001117767.1.24702 WP_001117767.1.24711 WP_001117767.1.24714 WP_001117767.1.24745 WP_001117767.1.24781 WP_001117767.1.2480 WP_001117767.1.24802 WP_001117767.1.24823 WP_001117767.1.24834 WP_001117767.1.24855 WP_001117767.1.24891 WP_001117767.1.24903 WP_001117767.1.24918 WP_001117767.1.24937 WP_001117767.1.2497 WP_001117767.1.24996 WP_001117767.1.25001 WP_001117767.1.25007 WP_001117767.1.2501 WP_001117767.1.25012 WP_001117767.1.25029 WP_001117767.1.2506 WP_001117767.1.25070 WP_001117767.1.25083 WP_001117767.1.25092 WP_001117767.1.25095 WP_001117767.1.25098 WP_001117767.1.25115 WP_001117767.1.25120 WP_001117767.1.25145 WP_001117767.1.25167 WP_001117767.1.25170 WP_001117767.1.25209 WP_001117767.1.25216 WP_001117767.1.2522 WP_001117767.1.25221 WP_001117767.1.25262 WP_001117767.1.25287 WP_001117767.1.25288 WP_001117767.1.25331 WP_001117767.1.25341 WP_001117767.1.25345 WP_001117767.1.25361 WP_001117767.1.25433 WP_001117767.1.25438 WP_001117767.1.2544 WP_001117767.1.25459 WP_001117767.1.25469 WP_001117767.1.25489 WP_001117767.1.25511 WP_001117767.1.2552 WP_001117767.1.25557 WP_001117767.1.25567 WP_001117767.1.25569 WP_001117767.1.25593 WP_001117767.1.25595 WP_001117767.1.25621 WP_001117767.1.25623 WP_001117767.1.25633 WP_001117767.1.25634 WP_001117767.1.25651 WP_001117767.1.257 WP_001117767.1.25721 WP_001117767.1.25732 WP_001117767.1.25737 WP_001117767.1.25758 WP_001117767.1.25770 WP_001117767.1.25772 WP_001117767.1.25776 WP_001117767.1.25779 WP_001117767.1.2579 WP_001117767.1.25801 WP_001117767.1.25802 WP_001117767.1.25820 WP_001117767.1.25840 WP_001117767.1.25852 WP_001117767.1.25856 WP_001117767.1.25857 WP_001117767.1.25868 WP_001117767.1.25881 WP_001117767.1.25891 WP_001117767.1.2590 WP_001117767.1.25910 WP_001117767.1.2592 WP_001117767.1.25924 WP_001117767.1.25929 WP_001117767.1.2593 WP_001117767.1.25930 WP_001117767.1.25955 WP_001117767.1.25984 WP_001117767.1.26006 WP_001117767.1.26012 WP_001117767.1.26015 WP_001117767.1.26033 WP_001117767.1.26039 WP_001117767.1.26050 WP_001117767.1.26058 WP_001117767.1.2608 WP_001117767.1.26086 WP_001117767.1.26094 WP_001117767.1.26106 WP_001117767.1.26169 WP_001117767.1.26172 WP_001117767.1.2619 WP_001117767.1.262 WP_001117767.1.2621 WP_001117767.1.26226 WP_001117767.1.26255 WP_001117767.1.26266 WP_001117767.1.26271 WP_001117767.1.26276 WP_001117767.1.26283 WP_001117767.1.26289 WP_001117767.1.26290 WP_001117767.1.26293 WP_001117767.1.26298 WP_001117767.1.26306 WP_001117767.1.26314 WP_001117767.1.26318 WP_001117767.1.2633 WP_001117767.1.26340 WP_001117767.1.26345 WP_001117767.1.26346 WP_001117767.1.26354 WP_001117767.1.26359 WP_001117767.1.26364 WP_001117767.1.26370 WP_001117767.1.26397 WP_001117767.1.26399 WP_001117767.1.26404 WP_001117767.1.26405 WP_001117767.1.26424 WP_001117767.1.2643 WP_001117767.1.26431 WP_001117767.1.2645 WP_001117767.1.26481 WP_001117767.1.26506 WP_001117767.1.26533 WP_001117767.1.2656 WP_001117767.1.2658 WP_001117767.1.26584 WP_001117767.1.2661 WP_001117767.1.26626 WP_001117767.1.2664 WP_001117767.1.26662 WP_001117767.1.26663 WP_001117767.1.26664 WP_001117767.1.26677 WP_001117767.1.26692 WP_001117767.1.26713 WP_001117767.1.26726 WP_001117767.1.2673 WP_001117767.1.26733 WP_001117767.1.2674 WP_001117767.1.26749 WP_001117767.1.26751 WP_001117767.1.26771 WP_001117767.1.26772 WP_001117767.1.26773 WP_001117767.1.26778 WP_001117767.1.26790 WP_001117767.1.2680 WP_001117767.1.26804 WP_001117767.1.2684 WP_001117767.1.26840 WP_001117767.1.26850 WP_001117767.1.26864 WP_001117767.1.26865 WP_001117767.1.2687 WP_001117767.1.26884 WP_001117767.1.2689 WP_001117767.1.26903 WP_001117767.1.26905 WP_001117767.1.26927 WP_001117767.1.26929 WP_001117767.1.26938 WP_001117767.1.26944 WP_001117767.1.26947 WP_001117767.1.26958 WP_001117767.1.26963 WP_001117767.1.2697 WP_001117767.1.27013 WP_001117767.1.27053 WP_001117767.1.27080 WP_001117767.1.27083 WP_001117767.1.2710 WP_001117767.1.27147 WP_001117767.1.27154 WP_001117767.1.27160 WP_001117767.1.27166 WP_001117767.1.27168 WP_001117767.1.27170 WP_001117767.1.2718 WP_001117767.1.27182 WP_001117767.1.2719 WP_001117767.1.27199 WP_001117767.1.27207 WP_001117767.1.27226 WP_001117767.1.27237 WP_001117767.1.27246 WP_001117767.1.2725 WP_001117767.1.27262 WP_001117767.1.27294 WP_001117767.1.27303 WP_001117767.1.27311 WP_001117767.1.27323 WP_001117767.1.27333 WP_001117767.1.2734 WP_001117767.1.27345 WP_001117767.1.27379 WP_001117767.1.27384 WP_001117767.1.27387 WP_001117767.1.27413 WP_001117767.1.2744 WP_001117767.1.27447 WP_001117767.1.27448 WP_001117767.1.27455 WP_001117767.1.27456 WP_001117767.1.27457 WP_001117767.1.27467 WP_001117767.1.27468 WP_001117767.1.27489 WP_001117767.1.27516 WP_001117767.1.27529 WP_001117767.1.2753 WP_001117767.1.27539 WP_001117767.1.27551 WP_001117767.1.27562 WP_001117767.1.2759 WP_001117767.1.27590 WP_001117767.1.27605 WP_001117767.1.27608 WP_001117767.1.27614 WP_001117767.1.27615 WP_001117767.1.27621 WP_001117767.1.27628 WP_001117767.1.27640 WP_001117767.1.27646 WP_001117767.1.27654 WP_001117767.1.27667 WP_001117767.1.27670 WP_001117767.1.27689 WP_001117767.1.27696 WP_001117767.1.27720 WP_001117767.1.27739 WP_001117767.1.27744 WP_001117767.1.27748 WP_001117767.1.27765 WP_001117767.1.27787 WP_001117767.1.27793 WP_001117767.1.27799 WP_001117767.1.27817 WP_001117767.1.27830 WP_001117767.1.27834 WP_001117767.1.27854 WP_001117767.1.27929 WP_001117767.1.2795 WP_001117767.1.27953 WP_001117767.1.27972 WP_001117767.1.2800 WP_001117767.1.28007 WP_001117767.1.28016 WP_001117767.1.28063 WP_001117767.1.28071 WP_001117767.1.28074 WP_001117767.1.28079 WP_001117767.1.2808 WP_001117767.1.28081 WP_001117767.1.28088 WP_001117767.1.28091 WP_001117767.1.28105 WP_001117767.1.28107 WP_001117767.1.28117 WP_001117767.1.28138 WP_001117767.1.28147 WP_001117767.1.28158 WP_001117767.1.28173 WP_001117767.1.28191 WP_001117767.1.28207 WP_001117767.1.28213 WP_001117767.1.28226 WP_001117767.1.28230 WP_001117767.1.28253 WP_001117767.1.28257 WP_001117767.1.28274 WP_001117767.1.28315 WP_001117767.1.28319 WP_001117767.1.28334 WP_001117767.1.28336 WP_001117767.1.28337 WP_001117767.1.28347 WP_001117767.1.28358 WP_001117767.1.28360 WP_001117767.1.28376 WP_001117767.1.28381 WP_001117767.1.28392 WP_001117767.1.28394 WP_001117767.1.28399 WP_001117767.1.2840 WP_001117767.1.28400 WP_001117767.1.28430 WP_001117767.1.28447 WP_001117767.1.28482 WP_001117767.1.28490 WP_001117767.1.28498 WP_001117767.1.28502 WP_001117767.1.2852 WP_001117767.1.28526 WP_001117767.1.28527 WP_001117767.1.28532 WP_001117767.1.28564 WP_001117767.1.28578 WP_001117767.1.28580 WP_001117767.1.28584 WP_001117767.1.28605 WP_001117767.1.28614 WP_001117767.1.2862 WP_001117767.1.28629 WP_001117767.1.28636 WP_001117767.1.28650 WP_001117767.1.28652 WP_001117767.1.28672 WP_001117767.1.28675 WP_001117767.1.28690 WP_001117767.1.28710 WP_001117767.1.28720 WP_001117767.1.28763 WP_001117767.1.28784 WP_001117767.1.28785 WP_001117767.1.28825 WP_001117767.1.28833 WP_001117767.1.28848 WP_001117767.1.28862 WP_001117767.1.28866 WP_001117767.1.28871 WP_001117767.1.28874 WP_001117767.1.28887 WP_001117767.1.28909 WP_001117767.1.2891 WP_001117767.1.28925 WP_001117767.1.28933 WP_001117767.1.28934 WP_001117767.1.28960 WP_001117767.1.28970 WP_001117767.1.28981 WP_001117767.1.28987 WP_001117767.1.29014 WP_001117767.1.29052 WP_001117767.1.2906 WP_001117767.1.29060 WP_001117767.1.29090 WP_001117767.1.29091 WP_001117767.1.29107 WP_001117767.1.29110 WP_001117767.1.29112 WP_001117767.1.2913 WP_001117767.1.29155 WP_001117767.1.29166 WP_001117767.1.29187 WP_001117767.1.29188 WP_001117767.1.29207 WP_001117767.1.29226 WP_001117767.1.29242 WP_001117767.1.29243 WP_001117767.1.29244 WP_001117767.1.29263 WP_001117767.1.29276 WP_001117767.1.29282 WP_001117767.1.29285 WP_001117767.1.29301 WP_001117767.1.29312 WP_001117767.1.29315 WP_001117767.1.29329 WP_001117767.1.29340 WP_001117767.1.29366 WP_001117767.1.29368 WP_001117767.1.29372 WP_001117767.1.29373 WP_001117767.1.29375 WP_001117767.1.29381 WP_001117767.1.29395 WP_001117767.1.29420 WP_001117767.1.29433 WP_001117767.1.29445 WP_001117767.1.29453 WP_001117767.1.29468 WP_001117767.1.29479 WP_001117767.1.29483 WP_001117767.1.29484 WP_001117767.1.29511 WP_001117767.1.29522 WP_001117767.1.29541 WP_001117767.1.29553 WP_001117767.1.29554 WP_001117767.1.29557 WP_001117767.1.29561 WP_001117767.1.2957 WP_001117767.1.29571 WP_001117767.1.29596 WP_001117767.1.29644 WP_001117767.1.29676 WP_001117767.1.29692 WP_001117767.1.29709 WP_001117767.1.29710 WP_001117767.1.29716 WP_001117767.1.2972 WP_001117767.1.29731 WP_001117767.1.29736 WP_001117767.1.29744 WP_001117767.1.2975 WP_001117767.1.29758 WP_001117767.1.29781 WP_001117767.1.29788 WP_001117767.1.29805 WP_001117767.1.2981 WP_001117767.1.29826 WP_001117767.1.2983 WP_001117767.1.29862 WP_001117767.1.29885 WP_001117767.1.29902 WP_001117767.1.29905 WP_001117767.1.29918 WP_001117767.1.29956 WP_001117767.1.29963 WP_001117767.1.2997 WP_001117767.1.29981 WP_001117767.1.29982 WP_001117767.1.30012 WP_001117767.1.30023 WP_001117767.1.30033 WP_001117767.1.30047 WP_001117767.1.30051 WP_001117767.1.30057 WP_001117767.1.30089 WP_001117767.1.30095 WP_001117767.1.30100 WP_001117767.1.30115 WP_001117767.1.3012 WP_001117767.1.30130 WP_001117767.1.30152 WP_001117767.1.30159 WP_001117767.1.30169 WP_001117767.1.30176 WP_001117767.1.30186 WP_001117767.1.30191 WP_001117767.1.30197 WP_001117767.1.30203 WP_001117767.1.30204 WP_001117767.1.30209 WP_001117767.1.30230 WP_001117767.1.30249 WP_001117767.1.30262 WP_001117767.1.30268 WP_001117767.1.30274 WP_001117767.1.3029 WP_001117767.1.30302 WP_001117767.1.30307 WP_001117767.1.30328 WP_001117767.1.30333 WP_001117767.1.30350 WP_001117767.1.30364 WP_001117767.1.30367 WP_001117767.1.30376 WP_001117767.1.30381 WP_001117767.1.30385 WP_001117767.1.30392 WP_001117767.1.30418 WP_001117767.1.30422 WP_001117767.1.30458 WP_001117767.1.30477 WP_001117767.1.30482 WP_001117767.1.30496 WP_001117767.1.3050 WP_001117767.1.30508 WP_001117767.1.30530 WP_001117767.1.30531 WP_001117767.1.30560 WP_001117767.1.30566 WP_001117767.1.30568 WP_001117767.1.30600 WP_001117767.1.30622 WP_001117767.1.30623 WP_001117767.1.30645 WP_001117767.1.30646 WP_001117767.1.30648 WP_001117767.1.30650 WP_001117767.1.30652 WP_001117767.1.30666 WP_001117767.1.30668 WP_001117767.1.30702 WP_001117767.1.30720 WP_001117767.1.30726 WP_001117767.1.30758 WP_001117767.1.30763 WP_001117767.1.3077 WP_001117767.1.30845 WP_001117767.1.30847 WP_001117767.1.30854 WP_001117767.1.30862 WP_001117767.1.30863 WP_001117767.1.30874 WP_001117767.1.30878 WP_001117767.1.30880 WP_001117767.1.30889 WP_001117767.1.30907 WP_001117767.1.30911 WP_001117767.1.30916 WP_001117767.1.30928 WP_001117767.1.30962 WP_001117767.1.3097 WP_001117767.1.30970 WP_001117767.1.30971 WP_001117767.1.30998 WP_001117767.1.31005 WP_001117767.1.31022 WP_001117767.1.31037 WP_001117767.1.31039 WP_001117767.1.31041 WP_001117767.1.31048 WP_001117767.1.31065 WP_001117767.1.31068 WP_001117767.1.31077 WP_001117767.1.31091 WP_001117767.1.31113 WP_001117767.1.31120 WP_001117767.1.31123 WP_001117767.1.31124 WP_001117767.1.31176 WP_001117767.1.31194 WP_001117767.1.31202 WP_001117767.1.31204 WP_001117767.1.31206 WP_001117767.1.31212 WP_001117767.1.3123 WP_001117767.1.31232 WP_001117767.1.31278 WP_001117767.1.31294 WP_001117767.1.31315 WP_001117767.1.3132 WP_001117767.1.31337 WP_001117767.1.31339 WP_001117767.1.31355 WP_001117767.1.31376 WP_001117767.1.31377 WP_001117767.1.31402 WP_001117767.1.31424 WP_001117767.1.31426 WP_001117767.1.31436 WP_001117767.1.31437 WP_001117767.1.31441 WP_001117767.1.31442 WP_001117767.1.31462 WP_001117767.1.31468 WP_001117767.1.31478 WP_001117767.1.31479 WP_001117767.1.31484 WP_001117767.1.31497 WP_001117767.1.315 WP_001117767.1.31505 WP_001117767.1.31529 WP_001117767.1.31531 WP_001117767.1.31539 WP_001117767.1.31567 WP_001117767.1.31568 WP_001117767.1.31589 WP_001117767.1.31605 WP_001117767.1.31611 WP_001117767.1.31621 WP_001117767.1.31642 WP_001117767.1.31647 WP_001117767.1.31653 WP_001117767.1.31667 WP_001117767.1.31686 WP_001117767.1.31701 WP_001117767.1.31743 WP_001117767.1.31753 WP_001117767.1.31787 WP_001117767.1.31791 WP_001117767.1.31797 WP_001117767.1.31806 WP_001117767.1.31816 WP_001117767.1.31817 WP_001117767.1.31827 WP_001117767.1.31828 WP_001117767.1.31842 WP_001117767.1.3188 WP_001117767.1.31892 WP_001117767.1.31897 WP_001117767.1.31925 WP_001117767.1.31931 WP_001117767.1.31943 WP_001117767.1.31949 WP_001117767.1.31994 WP_001117767.1.31997 WP_001117767.1.32003 WP_001117767.1.32005 WP_001117767.1.32029 WP_001117767.1.32040 WP_001117767.1.32059 WP_001117767.1.32067 WP_001117767.1.32077 WP_001117767.1.32095 WP_001117767.1.32118 WP_001117767.1.32122 WP_001117767.1.32125 WP_001117767.1.32130 WP_001117767.1.32160 WP_001117767.1.32167 WP_001117767.1.3219 WP_001117767.1.32207 WP_001117767.1.32217 WP_001117767.1.32244 WP_001117767.1.32248 WP_001117767.1.32270 WP_001117767.1.32281 WP_001117767.1.3229 WP_001117767.1.32295 WP_001117767.1.3231 WP_001117767.1.32325 WP_001117767.1.32338 WP_001117767.1.32339 WP_001117767.1.32340 WP_001117767.1.32348 WP_001117767.1.32365 WP_001117767.1.32384 WP_001117767.1.32405 WP_001117767.1.3242 WP_001117767.1.3244 WP_001117767.1.32464 WP_001117767.1.32474 WP_001117767.1.32481 WP_001117767.1.32483 WP_001117767.1.32497 WP_001117767.1.32514 WP_001117767.1.32517 WP_001117767.1.32534 WP_001117767.1.32546 WP_001117767.1.32555 WP_001117767.1.32565 WP_001117767.1.32584 WP_001117767.1.32588 WP_001117767.1.32599 WP_001117767.1.32607 WP_001117767.1.32634 WP_001117767.1.32636 WP_001117767.1.32645 WP_001117767.1.32671 WP_001117767.1.32739 WP_001117767.1.32746 WP_001117767.1.32754 WP_001117767.1.32761 WP_001117767.1.32763 WP_001117767.1.32764 WP_001117767.1.32770 WP_001117767.1.32795 WP_001117767.1.328 WP_001117767.1.32800 WP_001117767.1.32829 WP_001117767.1.32839 WP_001117767.1.32921 WP_001117767.1.32925 WP_001117767.1.32928 WP_001117767.1.3293 WP_001117767.1.32939 WP_001117767.1.32954 WP_001117767.1.32965 WP_001117767.1.32980 WP_001117767.1.32987 WP_001117767.1.3299 WP_001117767.1.3301 WP_001117767.1.33029 WP_001117767.1.33038 WP_001117767.1.33048 WP_001117767.1.3306 WP_001117767.1.33067 WP_001117767.1.33108 WP_001117767.1.33110 WP_001117767.1.33123 WP_001117767.1.33138 WP_001117767.1.33147 WP_001117767.1.33161 WP_001117767.1.33172 WP_001117767.1.33199 WP_001117767.1.33212 WP_001117767.1.33213 WP_001117767.1.33250 WP_001117767.1.33252 WP_001117767.1.33255 WP_001117767.1.33266 WP_001117767.1.33292 WP_001117767.1.33296 WP_001117767.1.3330 WP_001117767.1.33307 WP_001117767.1.33322 WP_001117767.1.33328 WP_001117767.1.33335 WP_001117767.1.3335 WP_001117767.1.33350 WP_001117767.1.33357 WP_001117767.1.33368 WP_001117767.1.3338 WP_001117767.1.3341 WP_001117767.1.33416 WP_001117767.1.3342 WP_001117767.1.3343 WP_001117767.1.3345 WP_001117767.1.33463 WP_001117767.1.33468 WP_001117767.1.3347 WP_001117767.1.33483 WP_001117767.1.33484 WP_001117767.1.33507 WP_001117767.1.33516 WP_001117767.1.33518 WP_001117767.1.33520 WP_001117767.1.33538 WP_001117767.1.33540 WP_001117767.1.33567 WP_001117767.1.3357 WP_001117767.1.33575 WP_001117767.1.33594 WP_001117767.1.33607 WP_001117767.1.33610 WP_001117767.1.33626 WP_001117767.1.33627 WP_001117767.1.3363 WP_001117767.1.33640 WP_001117767.1.33650 WP_001117767.1.33654 WP_001117767.1.33655 WP_001117767.1.33692 WP_001117767.1.33695 WP_001117767.1.33707 WP_001117767.1.33718 WP_001117767.1.33720 WP_001117767.1.33724 WP_001117767.1.33735 WP_001117767.1.33743 WP_001117767.1.33756 WP_001117767.1.33765 WP_001117767.1.33766 WP_001117767.1.33767 WP_001117767.1.33769 WP_001117767.1.33778 WP_001117767.1.33792 WP_001117767.1.33804 WP_001117767.1.33813 WP_001117767.1.33816 WP_001117767.1.33850 WP_001117767.1.33855 WP_001117767.1.33899 WP_001117767.1.33915 WP_001117767.1.33940 WP_001117767.1.33949 WP_001117767.1.33963 WP_001117767.1.33966 WP_001117767.1.33968 WP_001117767.1.33971 WP_001117767.1.33983 WP_001117767.1.33989 WP_001117767.1.33994 WP_001117767.1.34026 WP_001117767.1.34030 WP_001117767.1.34051 WP_001117767.1.34060 WP_001117767.1.34062 WP_001117767.1.34069 WP_001117767.1.34078 WP_001117767.1.34079 WP_001117767.1.34080 WP_001117767.1.34089 WP_001117767.1.34100 WP_001117767.1.34105 WP_001117767.1.34112 WP_001117767.1.34128 WP_001117767.1.34132 WP_001117767.1.34168 WP_001117767.1.34172 WP_001117767.1.3418 WP_001117767.1.34182 WP_001117767.1.34194 WP_001117767.1.34209 WP_001117767.1.3422 WP_001117767.1.34223 WP_001117767.1.34231 WP_001117767.1.34244 WP_001117767.1.34250 WP_001117767.1.34251 WP_001117767.1.34254 WP_001117767.1.34280 WP_001117767.1.34285 WP_001117767.1.34334 WP_001117767.1.34361 WP_001117767.1.34371 WP_001117767.1.34381 WP_001117767.1.34403 WP_001117767.1.34410 WP_001117767.1.3442 WP_001117767.1.34427 WP_001117767.1.34436 WP_001117767.1.34471 WP_001117767.1.34473 WP_001117767.1.3448 WP_001117767.1.34482 WP_001117767.1.34492 WP_001117767.1.34502 WP_001117767.1.34510 WP_001117767.1.34512 WP_001117767.1.34526 WP_001117767.1.34531 WP_001117767.1.34569 WP_001117767.1.3461 WP_001117767.1.34626 WP_001117767.1.34666 WP_001117767.1.34677 WP_001117767.1.34716 WP_001117767.1.34723 WP_001117767.1.34733 WP_001117767.1.34737 WP_001117767.1.3474 WP_001117767.1.34741 WP_001117767.1.34767 WP_001117767.1.34774 WP_001117767.1.34818 WP_001117767.1.34865 WP_001117767.1.34890 WP_001117767.1.34912 WP_001117767.1.34918 WP_001117767.1.34923 WP_001117767.1.34926 WP_001117767.1.34943 WP_001117767.1.34967 WP_001117767.1.34970 WP_001117767.1.34998 WP_001117767.1.35014 WP_001117767.1.35031 WP_001117767.1.35032 WP_001117767.1.35054 WP_001117767.1.35059 WP_001117767.1.35062 WP_001117767.1.35089 WP_001117767.1.35097 WP_001117767.1.35106 WP_001117767.1.35108 WP_001117767.1.35110 WP_001117767.1.35121 WP_001117767.1.35177 WP_001117767.1.35182 WP_001117767.1.35189 WP_001117767.1.35194 WP_001117767.1.35222 WP_001117767.1.35233 WP_001117767.1.35257 WP_001117767.1.35276 WP_001117767.1.35285 WP_001117767.1.35289 WP_001117767.1.35297 WP_001117767.1.35307 WP_001117767.1.35314 WP_001117767.1.35334 WP_001117767.1.35340 WP_001117767.1.35342 WP_001117767.1.35352 WP_001117767.1.35391 WP_001117767.1.354 WP_001117767.1.35413 WP_001117767.1.35415 WP_001117767.1.3542 WP_001117767.1.35423 WP_001117767.1.35435 WP_001117767.1.3547 WP_001117767.1.3549 WP_001117767.1.35490 WP_001117767.1.35497 WP_001117767.1.35498 WP_001117767.1.35506 WP_001117767.1.35508 WP_001117767.1.35517 WP_001117767.1.35519 WP_001117767.1.3552 WP_001117767.1.35525 WP_001117767.1.35549 WP_001117767.1.35580 WP_001117767.1.35615 WP_001117767.1.35623 WP_001117767.1.35642 WP_001117767.1.35643 WP_001117767.1.35659 WP_001117767.1.35661 WP_001117767.1.35673 WP_001117767.1.35686 WP_001117767.1.3569 WP_001117767.1.35696 WP_001117767.1.35730 WP_001117767.1.3574 WP_001117767.1.35742 WP_001117767.1.35746 WP_001117767.1.35774 WP_001117767.1.35784 WP_001117767.1.3579 WP_001117767.1.35794 WP_001117767.1.35799 WP_001117767.1.35801 WP_001117767.1.35826 WP_001117767.1.35888 WP_001117767.1.35890 WP_001117767.1.35900 WP_001117767.1.35903 WP_001117767.1.35928 WP_001117767.1.35950 WP_001117767.1.35958 WP_001117767.1.36004 WP_001117767.1.36021 WP_001117767.1.36041 WP_001117767.1.36082 WP_001117767.1.36093 WP_001117767.1.36102 WP_001117767.1.3611 WP_001117767.1.36117 WP_001117767.1.36119 WP_001117767.1.36141 WP_001117767.1.3617 WP_001117767.1.36175 WP_001117767.1.36176 WP_001117767.1.36179 WP_001117767.1.36187 WP_001117767.1.36188 WP_001117767.1.36193 WP_001117767.1.36208 WP_001117767.1.36211 WP_001117767.1.36220 WP_001117767.1.36223 WP_001117767.1.3623 WP_001117767.1.36249 WP_001117767.1.36250 WP_001117767.1.36264 WP_001117767.1.36278 WP_001117767.1.36282 WP_001117767.1.36283 WP_001117767.1.36302 WP_001117767.1.36307 WP_001117767.1.36325 WP_001117767.1.36344 WP_001117767.1.36389 WP_001117767.1.36430 WP_001117767.1.36434 WP_001117767.1.36439 WP_001117767.1.36522 WP_001117767.1.36532 WP_001117767.1.36535 WP_001117767.1.3655 WP_001117767.1.36551 WP_001117767.1.36570 WP_001117767.1.36580 WP_001117767.1.36600 WP_001117767.1.36604 WP_001117767.1.36615 WP_001117767.1.36640 WP_001117767.1.36646 WP_001117767.1.3666 WP_001117767.1.36669 WP_001117767.1.36689 WP_001117767.1.36697 WP_001117767.1.36698 WP_001117767.1.36704 WP_001117767.1.36729 WP_001117767.1.36745 WP_001117767.1.3675 WP_001117767.1.36754 WP_001117767.1.36770 WP_001117767.1.36773 WP_001117767.1.36783 WP_001117767.1.36793 WP_001117767.1.36796 WP_001117767.1.36797 WP_001117767.1.36809 WP_001117767.1.36822 WP_001117767.1.36823 WP_001117767.1.36847 WP_001117767.1.3685 WP_001117767.1.36858 WP_001117767.1.3687 WP_001117767.1.36884 WP_001117767.1.36888 WP_001117767.1.3690 WP_001117767.1.36903 WP_001117767.1.36911 WP_001117767.1.36916 WP_001117767.1.36932 WP_001117767.1.36952 WP_001117767.1.36955 WP_001117767.1.36962 WP_001117767.1.36979 WP_001117767.1.36980 WP_001117767.1.36983 WP_001117767.1.36997 WP_001117767.1.37002 WP_001117767.1.37016 WP_001117767.1.3703 WP_001117767.1.37044 WP_001117767.1.37045 WP_001117767.1.37053 WP_001117767.1.37055 WP_001117767.1.37075 WP_001117767.1.37080 WP_001117767.1.3709 WP_001117767.1.37091 WP_001117767.1.37120 WP_001117767.1.37121 WP_001117767.1.37130 WP_001117767.1.37132 WP_001117767.1.37134 WP_001117767.1.37135 WP_001117767.1.37145 WP_001117767.1.37159 WP_001117767.1.3718 WP_001117767.1.3719 WP_001117767.1.3722 WP_001117767.1.37220 WP_001117767.1.37240 WP_001117767.1.37304 WP_001117767.1.37335 WP_001117767.1.37354 WP_001117767.1.37398 WP_001117767.1.37408 WP_001117767.1.37411 WP_001117767.1.37424 WP_001117767.1.37435 WP_001117767.1.37453 WP_001117767.1.37467 WP_001117767.1.37503 WP_001117767.1.37525 WP_001117767.1.37536 WP_001117767.1.37563 WP_001117767.1.37578 WP_001117767.1.37583 WP_001117767.1.37602 WP_001117767.1.37605 WP_001117767.1.37606 WP_001117767.1.37621 WP_001117767.1.37624 WP_001117767.1.37636 WP_001117767.1.37644 WP_001117767.1.37652 WP_001117767.1.37669 WP_001117767.1.37679 WP_001117767.1.3774 WP_001117767.1.37749 WP_001117767.1.3776 WP_001117767.1.37764 WP_001117767.1.37771 WP_001117767.1.37781 WP_001117767.1.37788 WP_001117767.1.37795 WP_001117767.1.37815 WP_001117767.1.37828 WP_001117767.1.37851 WP_001117767.1.37855 WP_001117767.1.37866 WP_001117767.1.37875 WP_001117767.1.37878 WP_001117767.1.37891 WP_001117767.1.37906 WP_001117767.1.37907 WP_001117767.1.37929 WP_001117767.1.37953 WP_001117767.1.37987 WP_001117767.1.38007 WP_001117767.1.38020 WP_001117767.1.38030 WP_001117767.1.38034 WP_001117767.1.38038 WP_001117767.1.38057 WP_001117767.1.38070 WP_001117767.1.38082 WP_001117767.1.3809 WP_001117767.1.38111 WP_001117767.1.38128 WP_001117767.1.3813 WP_001117767.1.38136 WP_001117767.1.38148 WP_001117767.1.38160 WP_001117767.1.3817 WP_001117767.1.38177 WP_001117767.1.3820 WP_001117767.1.38212 WP_001117767.1.38222 WP_001117767.1.38229 WP_001117767.1.38230 WP_001117767.1.38232 WP_001117767.1.3827 WP_001117767.1.38276 WP_001117767.1.38282 WP_001117767.1.38304 WP_001117767.1.38309 WP_001117767.1.38311 WP_001117767.1.38316 WP_001117767.1.38330 WP_001117767.1.38336 WP_001117767.1.38339 WP_001117767.1.38346 WP_001117767.1.38383 WP_001117767.1.38390 WP_001117767.1.3842 WP_001117767.1.38422 WP_001117767.1.38435 WP_001117767.1.38437 WP_001117767.1.38453 WP_001117767.1.38489 WP_001117767.1.38493 WP_001117767.1.38516 WP_001117767.1.3852 WP_001117767.1.38522 WP_001117767.1.38546 WP_001117767.1.38551 WP_001117767.1.38555 WP_001117767.1.38557 WP_001117767.1.38600 WP_001117767.1.38607 WP_001117767.1.38612 WP_001117767.1.38637 WP_001117767.1.3867 WP_001117767.1.38674 WP_001117767.1.38688 WP_001117767.1.38721 WP_001117767.1.3875 WP_001117767.1.38760 WP_001117767.1.38786 WP_001117767.1.38823 WP_001117767.1.38836 WP_001117767.1.38841 WP_001117767.1.38858 WP_001117767.1.38862 WP_001117767.1.38875 WP_001117767.1.38885 WP_001117767.1.38890 WP_001117767.1.38926 WP_001117767.1.38927 WP_001117767.1.38931 WP_001117767.1.3894 WP_001117767.1.38940 WP_001117767.1.38941 WP_001117767.1.38943 WP_001117767.1.38960 WP_001117767.1.38972 WP_001117767.1.38973 WP_001117767.1.38979 WP_001117767.1.38985 WP_001117767.1.38989 WP_001117767.1.390 WP_001117767.1.39012 WP_001117767.1.39014 WP_001117767.1.39017 WP_001117767.1.39026 WP_001117767.1.39043 WP_001117767.1.39053 WP_001117767.1.3906 WP_001117767.1.3908 WP_001117767.1.391 WP_001117767.1.39108 WP_001117767.1.39117 WP_001117767.1.39126 WP_001117767.1.39166 WP_001117767.1.39173 WP_001117767.1.39203 WP_001117767.1.39206 WP_001117767.1.39217 WP_001117767.1.39241 WP_001117767.1.3926 WP_001117767.1.39272 WP_001117767.1.39281 WP_001117767.1.39285 WP_001117767.1.39290 WP_001117767.1.39324 WP_001117767.1.39332 WP_001117767.1.39333 WP_001117767.1.39361 WP_001117767.1.39368 WP_001117767.1.39378 WP_001117767.1.39384 WP_001117767.1.39397 WP_001117767.1.39406 WP_001117767.1.39432 WP_001117767.1.39451 WP_001117767.1.39486 WP_001117767.1.39494 WP_001117767.1.39499 WP_001117767.1.39506 WP_001117767.1.39519 WP_001117767.1.39527 WP_001117767.1.39542 WP_001117767.1.39550 WP_001117767.1.39613 WP_001117767.1.39625 WP_001117767.1.39645 WP_001117767.1.39662 WP_001117767.1.39670 WP_001117767.1.39671 WP_001117767.1.39682 WP_001117767.1.39687 WP_001117767.1.39689 WP_001117767.1.39693 WP_001117767.1.39697 WP_001117767.1.39711 WP_001117767.1.39738 WP_001117767.1.39767 WP_001117767.1.39773 WP_001117767.1.39789 WP_001117767.1.39812 WP_001117767.1.39832 WP_001117767.1.39834 WP_001117767.1.39838 WP_001117767.1.39839 WP_001117767.1.39856 WP_001117767.1.39857 WP_001117767.1.39869 WP_001117767.1.39875 WP_001117767.1.39880 WP_001117767.1.39918 WP_001117767.1.39943 WP_001117767.1.39995 WP_001117767.1.40014 WP_001117767.1.40043 WP_001117767.1.40053 WP_001117767.1.4006 WP_001117767.1.40076 WP_001117767.1.40082 WP_001117767.1.40085 WP_001117767.1.40099 WP_001117767.1.4010 WP_001117767.1.4012 WP_001117767.1.40120 WP_001117767.1.40130 WP_001117767.1.40137 WP_001117767.1.40149 WP_001117767.1.4015 WP_001117767.1.40161 WP_001117767.1.40164 WP_001117767.1.40173 WP_001117767.1.4019 WP_001117767.1.40220 WP_001117767.1.4025 WP_001117767.1.40299 WP_001117767.1.40316 WP_001117767.1.40318 WP_001117767.1.40320 WP_001117767.1.40322 WP_001117767.1.40329 WP_001117767.1.40330 WP_001117767.1.40342 WP_001117767.1.40368 WP_001117767.1.40369 WP_001117767.1.40383 WP_001117767.1.40401 WP_001117767.1.40406 WP_001117767.1.40409 WP_001117767.1.40428 WP_001117767.1.40435 WP_001117767.1.4045 WP_001117767.1.40454 WP_001117767.1.40463 WP_001117767.1.40472 WP_001117767.1.40474 WP_001117767.1.40481 WP_001117767.1.40483 WP_001117767.1.40500 WP_001117767.1.40505 WP_001117767.1.40531 WP_001117767.1.40532 WP_001117767.1.40554 WP_001117767.1.4056 WP_001117767.1.4057 WP_001117767.1.40579 WP_001117767.1.40588 WP_001117767.1.40613 WP_001117767.1.40620 WP_001117767.1.40644 WP_001117767.1.40655 WP_001117767.1.40658 WP_001117767.1.40659 WP_001117767.1.40670 WP_001117767.1.40700 WP_001117767.1.40719 WP_001117767.1.40729 WP_001117767.1.40748 WP_001117767.1.40760 WP_001117767.1.4078 WP_001117767.1.40780 WP_001117767.1.40794 WP_001117767.1.40797 WP_001117767.1.40800 WP_001117767.1.40816 WP_001117767.1.40939 WP_001117767.1.40954 WP_001117767.1.40997 WP_001117767.1.41002 WP_001117767.1.41011 WP_001117767.1.4102 WP_001117767.1.41033 WP_001117767.1.41038 WP_001117767.1.4105 WP_001117767.1.41058 WP_001117767.1.41064 WP_001117767.1.41084 WP_001117767.1.41094 WP_001117767.1.41098 WP_001117767.1.41104 WP_001117767.1.41109 WP_001117767.1.41119 WP_001117767.1.41122 WP_001117767.1.41129 WP_001117767.1.41133 WP_001117767.1.4115 WP_001117767.1.41178 WP_001117767.1.412 WP_001117767.1.41208 WP_001117767.1.41238 WP_001117767.1.41241 WP_001117767.1.41245 WP_001117767.1.41255 WP_001117767.1.41288 WP_001117767.1.41289 WP_001117767.1.4129 WP_001117767.1.41314 WP_001117767.1.41350 WP_001117767.1.41374 WP_001117767.1.4138 WP_001117767.1.41386 WP_001117767.1.41389 WP_001117767.1.41411 WP_001117767.1.41426 WP_001117767.1.41432 WP_001117767.1.41433 WP_001117767.1.4144 WP_001117767.1.41444 WP_001117767.1.41448 WP_001117767.1.41458 WP_001117767.1.41461 WP_001117767.1.41473 WP_001117767.1.41499 WP_001117767.1.41511 WP_001117767.1.41532 WP_001117767.1.41533 WP_001117767.1.41555 WP_001117767.1.41558 WP_001117767.1.41567 WP_001117767.1.41581 WP_001117767.1.41582 WP_001117767.1.41587 WP_001117767.1.41598 WP_001117767.1.41599 WP_001117767.1.4160 WP_001117767.1.41612 WP_001117767.1.4162 WP_001117767.1.41620 WP_001117767.1.41623 WP_001117767.1.41647 WP_001117767.1.41674 WP_001117767.1.41681 WP_001117767.1.4169 WP_001117767.1.41726 WP_001117767.1.41743 WP_001117767.1.41755 WP_001117767.1.41770 WP_001117767.1.41796 WP_001117767.1.41817 WP_001117767.1.4182 WP_001117767.1.41839 WP_001117767.1.41863 WP_001117767.1.4188 WP_001117767.1.41891 WP_001117767.1.41898 WP_001117767.1.41906 WP_001117767.1.41935 WP_001117767.1.41943 WP_001117767.1.41972 WP_001117767.1.41983 WP_001117767.1.41989 WP_001117767.1.420 WP_001117767.1.42001 WP_001117767.1.42003 WP_001117767.1.42005 WP_001117767.1.42015 WP_001117767.1.42017 WP_001117767.1.42028 WP_001117767.1.42064 WP_001117767.1.42072 WP_001117767.1.42085 WP_001117767.1.42087 WP_001117767.1.42125 WP_001117767.1.42137 WP_001117767.1.42169 WP_001117767.1.42177 WP_001117767.1.42178 WP_001117767.1.42198 WP_001117767.1.42230 WP_001117767.1.42241 WP_001117767.1.4225 WP_001117767.1.42269 WP_001117767.1.42286 WP_001117767.1.42305 WP_001117767.1.4231 WP_001117767.1.42325 WP_001117767.1.42336 WP_001117767.1.42355 WP_001117767.1.42403 WP_001117767.1.42436 WP_001117767.1.42438 WP_001117767.1.42455 WP_001117767.1.42459 WP_001117767.1.42460 WP_001117767.1.42481 WP_001117767.1.42503 WP_001117767.1.42510 WP_001117767.1.42517 WP_001117767.1.42551 WP_001117767.1.42575 WP_001117767.1.42593 WP_001117767.1.42598 WP_001117767.1.426 WP_001117767.1.4260 WP_001117767.1.42607 WP_001117767.1.42640 WP_001117767.1.42652 WP_001117767.1.42667 WP_001117767.1.42668 WP_001117767.1.42674 WP_001117767.1.42681 WP_001117767.1.42706 WP_001117767.1.42733 WP_001117767.1.42737 WP_001117767.1.42738 WP_001117767.1.42740 WP_001117767.1.42759 WP_001117767.1.42764 WP_001117767.1.42786 WP_001117767.1.42798 WP_001117767.1.42802 WP_001117767.1.42816 WP_001117767.1.42819 WP_001117767.1.42837 WP_001117767.1.42848 WP_001117767.1.42893 WP_001117767.1.42897 WP_001117767.1.42907 WP_001117767.1.42925 WP_001117767.1.4293 WP_001117767.1.42959 WP_001117767.1.42982 WP_001117767.1.42984 WP_001117767.1.42985 WP_001117767.1.4299 WP_001117767.1.42990 WP_001117767.1.4300 WP_001117767.1.43014 WP_001117767.1.43020 WP_001117767.1.43023 WP_001117767.1.43033 WP_001117767.1.43047 WP_001117767.1.43061 WP_001117767.1.43072 WP_001117767.1.43095 WP_001117767.1.43110 WP_001117767.1.43114 WP_001117767.1.43122 WP_001117767.1.43125 WP_001117767.1.43131 WP_001117767.1.43134 WP_001117767.1.43139 WP_001117767.1.43143 WP_001117767.1.43147 WP_001117767.1.43159 WP_001117767.1.43165 WP_001117767.1.43168 WP_001117767.1.43179 WP_001117767.1.43200 WP_001117767.1.43202 WP_001117767.1.43204 WP_001117767.1.43206 WP_001117767.1.43232 WP_001117767.1.43248 WP_001117767.1.4325 WP_001117767.1.43252 WP_001117767.1.43263 WP_001117767.1.4327 WP_001117767.1.43274 WP_001117767.1.43279 WP_001117767.1.43323 WP_001117767.1.43325 WP_001117767.1.43328 WP_001117767.1.43331 WP_001117767.1.43341 WP_001117767.1.43349 WP_001117767.1.43360 WP_001117767.1.43366 WP_001117767.1.43369 WP_001117767.1.4337 WP_001117767.1.43375 WP_001117767.1.43383 WP_001117767.1.43405 WP_001117767.1.43406 WP_001117767.1.4341 WP_001117767.1.43410 WP_001117767.1.43414 WP_001117767.1.43446 WP_001117767.1.43460 WP_001117767.1.4347 WP_001117767.1.43506 WP_001117767.1.43512 WP_001117767.1.43530 WP_001117767.1.43550 WP_001117767.1.43560 WP_001117767.1.43573 WP_001117767.1.43600 WP_001117767.1.43617 WP_001117767.1.43618 WP_001117767.1.43627 WP_001117767.1.43659 WP_001117767.1.43665 WP_001117767.1.43670 WP_001117767.1.43683 WP_001117767.1.43693 WP_001117767.1.4370 WP_001117767.1.43702 WP_001117767.1.43703 WP_001117767.1.4372 WP_001117767.1.43731 WP_001117767.1.4374 WP_001117767.1.43752 WP_001117767.1.43784 WP_001117767.1.43788 WP_001117767.1.43800 WP_001117767.1.43819 WP_001117767.1.43822 WP_001117767.1.43827 WP_001117767.1.4385 WP_001117767.1.43851 WP_001117767.1.4386 WP_001117767.1.43904 WP_001117767.1.43915 WP_001117767.1.43924 WP_001117767.1.43964 WP_001117767.1.43988 WP_001117767.1.43995 WP_001117767.1.44072 WP_001117767.1.44074 WP_001117767.1.44095 WP_001117767.1.44119 WP_001117767.1.44153 WP_001117767.1.44177 WP_001117767.1.44181 WP_001117767.1.44186 WP_001117767.1.44195 WP_001117767.1.44265 WP_001117767.1.44302 WP_001117767.1.44312 WP_001117767.1.44331 WP_001117767.1.44344 WP_001117767.1.44382 WP_001117767.1.44388 WP_001117767.1.44396 WP_001117767.1.44405 WP_001117767.1.44420 WP_001117767.1.44432 WP_001117767.1.44455 WP_001117767.1.44493 WP_001117767.1.44504 WP_001117767.1.44517 WP_001117767.1.44520 WP_001117767.1.44536 WP_001117767.1.44544 WP_001117767.1.44547 WP_001117767.1.44579 WP_001117767.1.44586 WP_001117767.1.44588 WP_001117767.1.44605 WP_001117767.1.44623 WP_001117767.1.44631 WP_001117767.1.44667 WP_001117767.1.44672 WP_001117767.1.44674 WP_001117767.1.44714 WP_001117767.1.44715 WP_001117767.1.44732 WP_001117767.1.44755 WP_001117767.1.44768 WP_001117767.1.44780 WP_001117767.1.44785 WP_001117767.1.44788 WP_001117767.1.44796 WP_001117767.1.44802 WP_001117767.1.44853 WP_001117767.1.44856 WP_001117767.1.44868 WP_001117767.1.44876 WP_001117767.1.44881 WP_001117767.1.44882 WP_001117767.1.44891 WP_001117767.1.44892 WP_001117767.1.44899 WP_001117767.1.44903 WP_001117767.1.44914 WP_001117767.1.44932 WP_001117767.1.44955 WP_001117767.1.44969 WP_001117767.1.4499 WP_001117767.1.44993 WP_001117767.1.45008 WP_001117767.1.45010 WP_001117767.1.45015 WP_001117767.1.45033 WP_001117767.1.45035 WP_001117767.1.45042 WP_001117767.1.45050 WP_001117767.1.45080 WP_001117767.1.45091 WP_001117767.1.45094 WP_001117767.1.45099 WP_001117767.1.45101 WP_001117767.1.45111 WP_001117767.1.45114 WP_001117767.1.4513 WP_001117767.1.45131 WP_001117767.1.45132 WP_001117767.1.45133 WP_001117767.1.45140 WP_001117767.1.45157 WP_001117767.1.45162 WP_001117767.1.45164 WP_001117767.1.45188 WP_001117767.1.45189 WP_001117767.1.452 WP_001117767.1.45218 WP_001117767.1.45221 WP_001117767.1.45223 WP_001117767.1.45242 WP_001117767.1.45267 WP_001117767.1.4527 WP_001117767.1.45272 WP_001117767.1.45281 WP_001117767.1.45290 WP_001117767.1.45297 WP_001117767.1.453 WP_001117767.1.45321 WP_001117767.1.45332 WP_001117767.1.45364 WP_001117767.1.45419 WP_001117767.1.45431 WP_001117767.1.45439 WP_001117767.1.45450 WP_001117767.1.45456 WP_001117767.1.4546 WP_001117767.1.45472 WP_001117767.1.45492 WP_001117767.1.4550 WP_001117767.1.45507 WP_001117767.1.45542 WP_001117767.1.45555 WP_001117767.1.45560 WP_001117767.1.45574 WP_001117767.1.45577 WP_001117767.1.45586 WP_001117767.1.45610 WP_001117767.1.45620 WP_001117767.1.45640 WP_001117767.1.45645 WP_001117767.1.45670 WP_001117767.1.45698 WP_001117767.1.45703 WP_001117767.1.45705 WP_001117767.1.45713 WP_001117767.1.45730 WP_001117767.1.45734 WP_001117767.1.45747 WP_001117767.1.45763 WP_001117767.1.45768 WP_001117767.1.4577 WP_001117767.1.45771 WP_001117767.1.45773 WP_001117767.1.45780 WP_001117767.1.4580 WP_001117767.1.4582 WP_001117767.1.45822 WP_001117767.1.45833 WP_001117767.1.4584 WP_001117767.1.45852 WP_001117767.1.45859 WP_001117767.1.45862 WP_001117767.1.45870 WP_001117767.1.45874 WP_001117767.1.45875 WP_001117767.1.45878 WP_001117767.1.45881 WP_001117767.1.45888 WP_001117767.1.45897 WP_001117767.1.459 WP_001117767.1.45954 WP_001117767.1.4597 WP_001117767.1.45977 WP_001117767.1.45979 WP_001117767.1.4598 WP_001117767.1.46003 WP_001117767.1.46005 WP_001117767.1.46013 WP_001117767.1.46021 WP_001117767.1.46035 WP_001117767.1.46037 WP_001117767.1.46050 WP_001117767.1.46055 WP_001117767.1.46062 WP_001117767.1.46071 WP_001117767.1.46082 WP_001117767.1.46087 WP_001117767.1.46106 WP_001117767.1.46109 WP_001117767.1.46136 WP_001117767.1.46168 WP_001117767.1.46171 WP_001117767.1.46172 WP_001117767.1.46185 WP_001117767.1.46195 WP_001117767.1.46208 WP_001117767.1.46212 WP_001117767.1.46222 WP_001117767.1.46228 WP_001117767.1.46248 WP_001117767.1.46259 WP_001117767.1.46276 WP_001117767.1.46289 WP_001117767.1.46320 WP_001117767.1.46330 WP_001117767.1.46333 WP_001117767.1.46334 WP_001117767.1.46339 WP_001117767.1.46353 WP_001117767.1.46362 WP_001117767.1.46368 WP_001117767.1.46380 WP_001117767.1.46389 WP_001117767.1.46401 WP_001117767.1.46418 WP_001117767.1.46422 WP_001117767.1.46457 WP_001117767.1.46465 WP_001117767.1.46514 WP_001117767.1.46528 WP_001117767.1.46534 WP_001117767.1.46543 WP_001117767.1.46587 WP_001117767.1.46619 WP_001117767.1.4662 WP_001117767.1.46648 WP_001117767.1.46660 WP_001117767.1.46664 WP_001117767.1.46670 WP_001117767.1.46676 WP_001117767.1.46688 WP_001117767.1.46692 WP_001117767.1.46702 WP_001117767.1.46703 WP_001117767.1.46720 WP_001117767.1.46736 WP_001117767.1.46752 WP_001117767.1.46765 WP_001117767.1.46767 WP_001117767.1.46770 WP_001117767.1.46772 WP_001117767.1.4680 WP_001117767.1.46815 WP_001117767.1.46823 WP_001117767.1.46837 WP_001117767.1.46852 WP_001117767.1.46875 WP_001117767.1.46881 WP_001117767.1.46906 WP_001117767.1.46908 WP_001117767.1.46911 WP_001117767.1.46914 WP_001117767.1.46925 WP_001117767.1.46929 WP_001117767.1.46937 WP_001117767.1.4694 WP_001117767.1.46947 WP_001117767.1.4696 WP_001117767.1.46964 WP_001117767.1.46965 WP_001117767.1.46983 WP_001117767.1.46995 WP_001117767.1.47002 WP_001117767.1.47051 WP_001117767.1.47090 WP_001117767.1.47105 WP_001117767.1.47107 WP_001117767.1.47111 WP_001117767.1.47128 WP_001117767.1.47153 WP_001117767.1.47159 WP_001117767.1.4716 WP_001117767.1.47163 WP_001117767.1.47175 WP_001117767.1.47187 WP_001117767.1.47193 WP_001117767.1.47205 WP_001117767.1.47211 WP_001117767.1.47216 WP_001117767.1.47218 WP_001117767.1.47250 WP_001117767.1.47269 WP_001117767.1.47276 WP_001117767.1.47279 WP_001117767.1.4728 WP_001117767.1.47282 WP_001117767.1.47290 WP_001117767.1.47294 WP_001117767.1.47306 WP_001117767.1.47317 WP_001117767.1.47328 WP_001117767.1.47331 WP_001117767.1.47334 WP_001117767.1.47353 WP_001117767.1.47381 WP_001117767.1.47383 WP_001117767.1.47399 WP_001117767.1.47405 WP_001117767.1.47406 WP_001117767.1.47408 WP_001117767.1.47422 WP_001117767.1.47426 WP_001117767.1.47432 WP_001117767.1.47439 WP_001117767.1.47450 WP_001117767.1.47459 WP_001117767.1.4752 WP_001117767.1.47522 WP_001117767.1.47541 WP_001117767.1.47560 WP_001117767.1.47561 WP_001117767.1.47570 WP_001117767.1.47577 WP_001117767.1.47617 WP_001117767.1.47618 WP_001117767.1.47629 WP_001117767.1.47669 WP_001117767.1.4767 WP_001117767.1.47680 WP_001117767.1.477 WP_001117767.1.47702 WP_001117767.1.47719 WP_001117767.1.47733 WP_001117767.1.47747 WP_001117767.1.47763 WP_001117767.1.47782 WP_001117767.1.47792 WP_001117767.1.47821 WP_001117767.1.47835 WP_001117767.1.47836 WP_001117767.1.47851 WP_001117767.1.47859 WP_001117767.1.47872 WP_001117767.1.47873 WP_001117767.1.47888 WP_001117767.1.47901 WP_001117767.1.47904 WP_001117767.1.47908 WP_001117767.1.4792 WP_001117767.1.47951 WP_001117767.1.47980 WP_001117767.1.47989 WP_001117767.1.47996 WP_001117767.1.48009 WP_001117767.1.48011 WP_001117767.1.48013 WP_001117767.1.48030 WP_001117767.1.48046 WP_001117767.1.48047 WP_001117767.1.4805 WP_001117767.1.48057 WP_001117767.1.48067 WP_001117767.1.48116 WP_001117767.1.48142 WP_001117767.1.48149 WP_001117767.1.4815 WP_001117767.1.48154 WP_001117767.1.48156 WP_001117767.1.48169 WP_001117767.1.48186 WP_001117767.1.48187 WP_001117767.1.48197 WP_001117767.1.48199 WP_001117767.1.48205 WP_001117767.1.48212 WP_001117767.1.48223 WP_001117767.1.48227 WP_001117767.1.48236 WP_001117767.1.48250 WP_001117767.1.48272 WP_001117767.1.48282 WP_001117767.1.48284 WP_001117767.1.48293 WP_001117767.1.48307 WP_001117767.1.48310 WP_001117767.1.48322 WP_001117767.1.48326 WP_001117767.1.48335 WP_001117767.1.48364 WP_001117767.1.48376 WP_001117767.1.48391 WP_001117767.1.48394 WP_001117767.1.48398 WP_001117767.1.484 WP_001117767.1.48425 WP_001117767.1.48427 WP_001117767.1.48437 WP_001117767.1.48438 WP_001117767.1.48463 WP_001117767.1.48479 WP_001117767.1.48492 WP_001117767.1.4852 WP_001117767.1.48556 WP_001117767.1.48563 WP_001117767.1.48577 WP_001117767.1.48580 WP_001117767.1.48593 WP_001117767.1.48601 WP_001117767.1.48634 WP_001117767.1.48655 WP_001117767.1.48656 WP_001117767.1.48670 WP_001117767.1.4868 WP_001117767.1.48694 WP_001117767.1.48705 WP_001117767.1.48711 WP_001117767.1.48723 WP_001117767.1.48769 WP_001117767.1.48775 WP_001117767.1.48786 WP_001117767.1.48805 WP_001117767.1.48817 WP_001117767.1.48818 WP_001117767.1.48823 WP_001117767.1.48833 WP_001117767.1.48835 WP_001117767.1.4886 WP_001117767.1.48869 WP_001117767.1.48941 WP_001117767.1.48945 WP_001117767.1.48951 WP_001117767.1.48966 WP_001117767.1.48968 WP_001117767.1.48982 WP_001117767.1.48993 WP_001117767.1.4901 WP_001117767.1.49018 WP_001117767.1.49032 WP_001117767.1.4905 WP_001117767.1.49071 WP_001117767.1.49094 WP_001117767.1.49128 WP_001117767.1.49129 WP_001117767.1.49143 WP_001117767.1.49150 WP_001117767.1.49152 WP_001117767.1.49154 WP_001117767.1.49159 WP_001117767.1.4916 WP_001117767.1.49161 WP_001117767.1.4917 WP_001117767.1.49171 WP_001117767.1.49173 WP_001117767.1.4918 WP_001117767.1.49189 WP_001117767.1.49196 WP_001117767.1.49199 WP_001117767.1.49207 WP_001117767.1.4921 WP_001117767.1.49234 WP_001117767.1.49248 WP_001117767.1.49257 WP_001117767.1.49301 WP_001117767.1.49326 WP_001117767.1.49327 WP_001117767.1.49330 WP_001117767.1.49367 WP_001117767.1.49373 WP_001117767.1.49398 WP_001117767.1.49418 WP_001117767.1.49444 WP_001117767.1.4945 WP_001117767.1.49479 WP_001117767.1.49484 WP_001117767.1.4950 WP_001117767.1.49518 WP_001117767.1.49530 WP_001117767.1.49539 WP_001117767.1.49549 WP_001117767.1.49573 WP_001117767.1.49581 WP_001117767.1.49582 WP_001117767.1.496 WP_001117767.1.49603 WP_001117767.1.49605 WP_001117767.1.4962 WP_001117767.1.49643 WP_001117767.1.49653 WP_001117767.1.49658 WP_001117767.1.49669 WP_001117767.1.49671 WP_001117767.1.49672 WP_001117767.1.49690 WP_001117767.1.49704 WP_001117767.1.49707 WP_001117767.1.49715 WP_001117767.1.49728 WP_001117767.1.49730 WP_001117767.1.49732 WP_001117767.1.49742 WP_001117767.1.49745 WP_001117767.1.49757 WP_001117767.1.4980 WP_001117767.1.49800 WP_001117767.1.49819 WP_001117767.1.4982 WP_001117767.1.4984 WP_001117767.1.49860 WP_001117767.1.49863 WP_001117767.1.4987 WP_001117767.1.49871 WP_001117767.1.4989 WP_001117767.1.49894 WP_001117767.1.49907 WP_001117767.1.49912 WP_001117767.1.49913 WP_001117767.1.49917 WP_001117767.1.49918 WP_001117767.1.49921 WP_001117767.1.49934 WP_001117767.1.49935 WP_001117767.1.49936 WP_001117767.1.4994 WP_001117767.1.49943 WP_001117767.1.49951 WP_001117767.1.49970 WP_001117767.1.49982 WP_001117767.1.50013 WP_001117767.1.50015 WP_001117767.1.50023 WP_001117767.1.50028 WP_001117767.1.50038 WP_001117767.1.50039 WP_001117767.1.50061 WP_001117767.1.50064 WP_001117767.1.50076 WP_001117767.1.50117 WP_001117767.1.5013 WP_001117767.1.50138 WP_001117767.1.50145 WP_001117767.1.50175 WP_001117767.1.50192 WP_001117767.1.50212 WP_001117767.1.50217 WP_001117767.1.50219 WP_001117767.1.50229 WP_001117767.1.50261 WP_001117767.1.50291 WP_001117767.1.50313 WP_001117767.1.50314 WP_001117767.1.5035 WP_001117767.1.50356 WP_001117767.1.50360 WP_001117767.1.50367 WP_001117767.1.50369 WP_001117767.1.50377 WP_001117767.1.50388 WP_001117767.1.50424 WP_001117767.1.50425 WP_001117767.1.50430 WP_001117767.1.50431 WP_001117767.1.50440 WP_001117767.1.5045 WP_001117767.1.50464 WP_001117767.1.50477 WP_001117767.1.50516 WP_001117767.1.50525 WP_001117767.1.50527 WP_001117767.1.50536 WP_001117767.1.50543 WP_001117767.1.50555 WP_001117767.1.50556 WP_001117767.1.50568 WP_001117767.1.50578 WP_001117767.1.5059 WP_001117767.1.50594 WP_001117767.1.50595 WP_001117767.1.50647 WP_001117767.1.50660 WP_001117767.1.50669 WP_001117767.1.50699 WP_001117767.1.50732 WP_001117767.1.50740 WP_001117767.1.50742 WP_001117767.1.50748 WP_001117767.1.50759 WP_001117767.1.50768 WP_001117767.1.50799 WP_001117767.1.50817 WP_001117767.1.50820 WP_001117767.1.50827 WP_001117767.1.50829 WP_001117767.1.5087 WP_001117767.1.50884 WP_001117767.1.50896 WP_001117767.1.50937 WP_001117767.1.50958 WP_001117767.1.50962 WP_001117767.1.50974 WP_001117767.1.51008 WP_001117767.1.51015 WP_001117767.1.51031 WP_001117767.1.51062 WP_001117767.1.5108 WP_001117767.1.51085 WP_001117767.1.5109 WP_001117767.1.5110 WP_001117767.1.5111 WP_001117767.1.51130 WP_001117767.1.51138 WP_001117767.1.51152 WP_001117767.1.5117 WP_001117767.1.51194 WP_001117767.1.51209 WP_001117767.1.51220 WP_001117767.1.51226 WP_001117767.1.51236 WP_001117767.1.51245 WP_001117767.1.51250 WP_001117767.1.51277 WP_001117767.1.51282 WP_001117767.1.51295 WP_001117767.1.51306 WP_001117767.1.51310 WP_001117767.1.51326 WP_001117767.1.51346 WP_001117767.1.51365 WP_001117767.1.51376 WP_001117767.1.51377 WP_001117767.1.51393 WP_001117767.1.51403 WP_001117767.1.51418 WP_001117767.1.5145 WP_001117767.1.51454 WP_001117767.1.51456 WP_001117767.1.51465 WP_001117767.1.51469 WP_001117767.1.51492 WP_001117767.1.51496 WP_001117767.1.515 WP_001117767.1.51527 WP_001117767.1.5155 WP_001117767.1.51557 WP_001117767.1.51559 WP_001117767.1.51571 WP_001117767.1.51575 WP_001117767.1.51590 WP_001117767.1.51619 WP_001117767.1.51623 WP_001117767.1.51657 WP_001117767.1.51665 WP_001117767.1.51672 WP_001117767.1.51702 WP_001117767.1.51713 WP_001117767.1.51716 WP_001117767.1.51744 WP_001117767.1.51748 WP_001117767.1.51751 WP_001117767.1.51787 WP_001117767.1.51794 WP_001117767.1.51797 WP_001117767.1.51812 WP_001117767.1.51824 WP_001117767.1.51836 WP_001117767.1.51842 WP_001117767.1.5186 WP_001117767.1.51866 WP_001117767.1.51871 WP_001117767.1.51883 WP_001117767.1.5190 WP_001117767.1.51912 WP_001117767.1.51920 WP_001117767.1.51924 WP_001117767.1.51936 WP_001117767.1.51952 WP_001117767.1.51971 WP_001117767.1.51995 WP_001117767.1.52034 WP_001117767.1.52061 WP_001117767.1.52072 WP_001117767.1.52078 WP_001117767.1.5209 WP_001117767.1.521 WP_001117767.1.5213 WP_001117767.1.52151 WP_001117767.1.52162 WP_001117767.1.52182 WP_001117767.1.52185 WP_001117767.1.52193 WP_001117767.1.52195 WP_001117767.1.52198 WP_001117767.1.52210 WP_001117767.1.52224 WP_001117767.1.52251 WP_001117767.1.52252 WP_001117767.1.52259 WP_001117767.1.52289 WP_001117767.1.52296 WP_001117767.1.523 WP_001117767.1.52308 WP_001117767.1.52322 WP_001117767.1.52327 WP_001117767.1.52331 WP_001117767.1.52340 WP_001117767.1.52343 WP_001117767.1.52377 WP_001117767.1.52396 WP_001117767.1.52423 WP_001117767.1.52427 WP_001117767.1.52440 WP_001117767.1.52442 WP_001117767.1.52452 WP_001117767.1.52463 WP_001117767.1.52474 WP_001117767.1.5251 WP_001117767.1.52511 WP_001117767.1.52518 WP_001117767.1.52536 WP_001117767.1.52548 WP_001117767.1.52595 WP_001117767.1.52602 WP_001117767.1.52605 WP_001117767.1.52622 WP_001117767.1.52623 WP_001117767.1.52624 WP_001117767.1.52633 WP_001117767.1.52645 WP_001117767.1.52660 WP_001117767.1.52670 WP_001117767.1.52687 WP_001117767.1.52699 WP_001117767.1.52715 WP_001117767.1.52722 WP_001117767.1.52751 WP_001117767.1.52772 WP_001117767.1.52820 WP_001117767.1.52828 WP_001117767.1.52830 WP_001117767.1.52838 WP_001117767.1.52848 WP_001117767.1.52865 WP_001117767.1.52877 WP_001117767.1.52878 WP_001117767.1.52886 WP_001117767.1.52889 WP_001117767.1.52900 WP_001117767.1.52904 WP_001117767.1.52941 WP_001117767.1.52947 WP_001117767.1.52965 WP_001117767.1.52983 WP_001117767.1.52984 WP_001117767.1.52992 WP_001117767.1.53002 WP_001117767.1.53007 WP_001117767.1.53022 WP_001117767.1.5304 WP_001117767.1.53050 WP_001117767.1.53057 WP_001117767.1.53060 WP_001117767.1.53069 WP_001117767.1.53071 WP_001117767.1.53077 WP_001117767.1.53109 WP_001117767.1.53140 WP_001117767.1.53153 WP_001117767.1.53178 WP_001117767.1.5319 WP_001117767.1.53209 WP_001117767.1.5321 WP_001117767.1.5323 WP_001117767.1.53245 WP_001117767.1.53260 WP_001117767.1.53285 WP_001117767.1.53312 WP_001117767.1.53317 WP_001117767.1.53319 WP_001117767.1.53323 WP_001117767.1.53352 WP_001117767.1.5336 WP_001117767.1.53363 WP_001117767.1.53366 WP_001117767.1.53372 WP_001117767.1.53373 WP_001117767.1.53379 WP_001117767.1.53383 WP_001117767.1.53387 WP_001117767.1.53394 WP_001117767.1.53403 WP_001117767.1.53408 WP_001117767.1.53418 WP_001117767.1.53432 WP_001117767.1.53433 WP_001117767.1.53444 WP_001117767.1.53452 WP_001117767.1.53462 WP_001117767.1.53467 WP_001117767.1.53488 WP_001117767.1.53503 WP_001117767.1.53521 WP_001117767.1.53577 WP_001117767.1.53641 WP_001117767.1.53648 WP_001117767.1.53661 WP_001117767.1.53671 WP_001117767.1.53682 WP_001117767.1.53691 WP_001117767.1.53712 WP_001117767.1.53714 WP_001117767.1.53758 WP_001117767.1.53759 WP_001117767.1.53763 WP_001117767.1.53766 WP_001117767.1.53774 WP_001117767.1.53786 WP_001117767.1.53799 WP_001117767.1.5382 WP_001117767.1.53827 WP_001117767.1.53835 WP_001117767.1.53889 WP_001117767.1.53911 WP_001117767.1.53915 WP_001117767.1.53924 WP_001117767.1.53926 WP_001117767.1.53934 WP_001117767.1.53969 WP_001117767.1.53999 WP_001117767.1.5401 WP_001117767.1.54022 WP_001117767.1.54049 WP_001117767.1.54074 WP_001117767.1.54086 WP_001117767.1.54094 WP_001117767.1.54109 WP_001117767.1.54135 WP_001117767.1.54147 WP_001117767.1.54161 WP_001117767.1.54199 WP_001117767.1.54229 WP_001117767.1.54237 WP_001117767.1.54253 WP_001117767.1.54269 WP_001117767.1.54282 WP_001117767.1.54297 WP_001117767.1.54299 WP_001117767.1.54332 WP_001117767.1.54373 WP_001117767.1.54395 WP_001117767.1.544 WP_001117767.1.54404 WP_001117767.1.54413 WP_001117767.1.54426 WP_001117767.1.54438 WP_001117767.1.54446 WP_001117767.1.54471 WP_001117767.1.54477 WP_001117767.1.54479 WP_001117767.1.54491 WP_001117767.1.54503 WP_001117767.1.54510 WP_001117767.1.54518 WP_001117767.1.54539 WP_001117767.1.54543 WP_001117767.1.54551 WP_001117767.1.54554 WP_001117767.1.54572 WP_001117767.1.54637 WP_001117767.1.54675 WP_001117767.1.54689 WP_001117767.1.5469 WP_001117767.1.54728 WP_001117767.1.54733 WP_001117767.1.54744 WP_001117767.1.54745 WP_001117767.1.54753 WP_001117767.1.54819 WP_001117767.1.54826 WP_001117767.1.54847 WP_001117767.1.54878 WP_001117767.1.54914 WP_001117767.1.54931 WP_001117767.1.54955 WP_001117767.1.54967 WP_001117767.1.54990 WP_001117767.1.54995 WP_001117767.1.5500 WP_001117767.1.55004 WP_001117767.1.55014 WP_001117767.1.55058 WP_001117767.1.55082 WP_001117767.1.55084 WP_001117767.1.55090 WP_001117767.1.55095 WP_001117767.1.55100 WP_001117767.1.55139 WP_001117767.1.5518 WP_001117767.1.5519 WP_001117767.1.55192 WP_001117767.1.552 WP_001117767.1.55214 WP_001117767.1.55220 WP_001117767.1.55239 WP_001117767.1.55271 WP_001117767.1.55272 WP_001117767.1.55274 WP_001117767.1.55301 WP_001117767.1.55306 WP_001117767.1.55309 WP_001117767.1.55327 WP_001117767.1.55336 WP_001117767.1.55352 WP_001117767.1.55353 WP_001117767.1.5536 WP_001117767.1.55367 WP_001117767.1.55369 WP_001117767.1.55403 WP_001117767.1.55405 WP_001117767.1.55419 WP_001117767.1.55421 WP_001117767.1.55442 WP_001117767.1.55495 WP_001117767.1.5550 WP_001117767.1.55508 WP_001117767.1.55527 WP_001117767.1.55535 WP_001117767.1.55538 WP_001117767.1.5554 WP_001117767.1.55544 WP_001117767.1.55558 WP_001117767.1.5556 WP_001117767.1.55573 WP_001117767.1.55583 WP_001117767.1.5559 WP_001117767.1.55603 WP_001117767.1.55620 WP_001117767.1.55628 WP_001117767.1.55637 WP_001117767.1.5565 WP_001117767.1.55653 WP_001117767.1.55657 WP_001117767.1.557 WP_001117767.1.55717 WP_001117767.1.55719 WP_001117767.1.55724 WP_001117767.1.55728 WP_001117767.1.55746 WP_001117767.1.5575 WP_001117767.1.55784 WP_001117767.1.55786 WP_001117767.1.5580 WP_001117767.1.55818 WP_001117767.1.55831 WP_001117767.1.55835 WP_001117767.1.55839 WP_001117767.1.55845 WP_001117767.1.55848 WP_001117767.1.55854 WP_001117767.1.55859 WP_001117767.1.55867 WP_001117767.1.55874 WP_001117767.1.55886 WP_001117767.1.5589 WP_001117767.1.5590 WP_001117767.1.55904 WP_001117767.1.55916 WP_001117767.1.55933 WP_001117767.1.55949 WP_001117767.1.55953 WP_001117767.1.55955 WP_001117767.1.55960 WP_001117767.1.55985 WP_001117767.1.56000 WP_001117767.1.56003 WP_001117767.1.56025 WP_001117767.1.56039 WP_001117767.1.5604 WP_001117767.1.56048 WP_001117767.1.56064 WP_001117767.1.56078 WP_001117767.1.56098 WP_001117767.1.56099 WP_001117767.1.56106 WP_001117767.1.56135 WP_001117767.1.56153 WP_001117767.1.56200 WP_001117767.1.56210 WP_001117767.1.56213 WP_001117767.1.56214 WP_001117767.1.56220 WP_001117767.1.56225 WP_001117767.1.5623 WP_001117767.1.56237 WP_001117767.1.56239 WP_001117767.1.56241 WP_001117767.1.56260 WP_001117767.1.56272 WP_001117767.1.56275 WP_001117767.1.56281 WP_001117767.1.56332 WP_001117767.1.56333 WP_001117767.1.56343 WP_001117767.1.5635 WP_001117767.1.56364 WP_001117767.1.5637 WP_001117767.1.56377 WP_001117767.1.56387 WP_001117767.1.56400 WP_001117767.1.5644 WP_001117767.1.56444 WP_001117767.1.56453 WP_001117767.1.56464 WP_001117767.1.56482 WP_001117767.1.56496 WP_001117767.1.56522 WP_001117767.1.56525 WP_001117767.1.56527 WP_001117767.1.56530 WP_001117767.1.56542 WP_001117767.1.56558 WP_001117767.1.56570 WP_001117767.1.5658 WP_001117767.1.56584 WP_001117767.1.56598 WP_001117767.1.566 WP_001117767.1.56608 WP_001117767.1.56619 WP_001117767.1.56628 WP_001117767.1.56641 WP_001117767.1.5665 WP_001117767.1.56658 WP_001117767.1.5666 WP_001117767.1.56679 WP_001117767.1.56696 WP_001117767.1.56702 WP_001117767.1.56708 WP_001117767.1.56722 WP_001117767.1.5675 WP_001117767.1.56767 WP_001117767.1.5677 WP_001117767.1.56772 WP_001117767.1.56778 WP_001117767.1.56794 WP_001117767.1.56806 WP_001117767.1.56815 WP_001117767.1.56822 WP_001117767.1.56856 WP_001117767.1.5686 WP_001117767.1.56865 WP_001117767.1.56878 WP_001117767.1.569 WP_001117767.1.56903 WP_001117767.1.56931 WP_001117767.1.56966 WP_001117767.1.56975 WP_001117767.1.56986 WP_001117767.1.57015 WP_001117767.1.57024 WP_001117767.1.57047 WP_001117767.1.5705 WP_001117767.1.57073 WP_001117767.1.57075 WP_001117767.1.57080 WP_001117767.1.57081 WP_001117767.1.57097 WP_001117767.1.57109 WP_001117767.1.57115 WP_001117767.1.57141 WP_001117767.1.57158 WP_001117767.1.57170 WP_001117767.1.57175 WP_001117767.1.5718 WP_001117767.1.57190 WP_001117767.1.57196 WP_001117767.1.57214 WP_001117767.1.57223 WP_001117767.1.57265 WP_001117767.1.57271 WP_001117767.1.57291 WP_001117767.1.57309 WP_001117767.1.57316 WP_001117767.1.57330 WP_001117767.1.57338 WP_001117767.1.5735 WP_001117767.1.57370 WP_001117767.1.57376 WP_001117767.1.57385 WP_001117767.1.57389 WP_001117767.1.57427 WP_001117767.1.5743 WP_001117767.1.57445 WP_001117767.1.57448 WP_001117767.1.57459 WP_001117767.1.57481 WP_001117767.1.5749 WP_001117767.1.57507 WP_001117767.1.5752 WP_001117767.1.57577 WP_001117767.1.57593 WP_001117767.1.57594 WP_001117767.1.57612 WP_001117767.1.5763 WP_001117767.1.57635 WP_001117767.1.57650 WP_001117767.1.57665 WP_001117767.1.57670 WP_001117767.1.57682 WP_001117767.1.57692 WP_001117767.1.57693 WP_001117767.1.5770 WP_001117767.1.57701 WP_001117767.1.57718 WP_001117767.1.57720 WP_001117767.1.57723 WP_001117767.1.57727 WP_001117767.1.57730 WP_001117767.1.57734 WP_001117767.1.57745 WP_001117767.1.57754 WP_001117767.1.57761 WP_001117767.1.57770 WP_001117767.1.57783 WP_001117767.1.57808 WP_001117767.1.57819 WP_001117767.1.57837 WP_001117767.1.57840 WP_001117767.1.57844 WP_001117767.1.57861 WP_001117767.1.57875 WP_001117767.1.57878 WP_001117767.1.57888 WP_001117767.1.579 WP_001117767.1.5791 WP_001117767.1.57910 WP_001117767.1.57915 WP_001117767.1.57928 WP_001117767.1.57943 WP_001117767.1.57944 WP_001117767.1.57952 WP_001117767.1.57962 WP_001117767.1.57974 WP_001117767.1.5799 WP_001117767.1.58005 WP_001117767.1.58006 WP_001117767.1.58014 WP_001117767.1.58016 WP_001117767.1.58017 WP_001117767.1.58035 WP_001117767.1.58049 WP_001117767.1.58050 WP_001117767.1.58074 WP_001117767.1.58116 WP_001117767.1.58122 WP_001117767.1.58127 WP_001117767.1.58139 WP_001117767.1.58148 WP_001117767.1.58158 WP_001117767.1.5816 WP_001117767.1.5817 WP_001117767.1.58175 WP_001117767.1.58198 WP_001117767.1.58212 WP_001117767.1.58241 WP_001117767.1.58246 WP_001117767.1.5827 WP_001117767.1.58277 WP_001117767.1.58317 WP_001117767.1.58321 WP_001117767.1.58325 WP_001117767.1.58350 WP_001117767.1.58352 WP_001117767.1.58353 WP_001117767.1.58364 WP_001117767.1.58366 WP_001117767.1.58373 WP_001117767.1.58388 WP_001117767.1.58392 WP_001117767.1.58395 WP_001117767.1.58413 WP_001117767.1.58419 WP_001117767.1.58421 WP_001117767.1.58430 WP_001117767.1.58435 WP_001117767.1.58473 WP_001117767.1.58495 WP_001117767.1.58497 WP_001117767.1.58508 WP_001117767.1.58512 WP_001117767.1.58521 WP_001117767.1.58530 WP_001117767.1.58538 WP_001117767.1.58549 WP_001117767.1.5857 WP_001117767.1.58571 WP_001117767.1.58584 WP_001117767.1.58588 WP_001117767.1.58592 WP_001117767.1.58598 WP_001117767.1.586 WP_001117767.1.58626 WP_001117767.1.58686 WP_001117767.1.58701 WP_001117767.1.58704 WP_001117767.1.58714 WP_001117767.1.58718 WP_001117767.1.58735 WP_001117767.1.58760 WP_001117767.1.58763 WP_001117767.1.58772 WP_001117767.1.58775 WP_001117767.1.58798 WP_001117767.1.5880 WP_001117767.1.58833 WP_001117767.1.58855 WP_001117767.1.58860 WP_001117767.1.58934 WP_001117767.1.58936 WP_001117767.1.58960 WP_001117767.1.58981 WP_001117767.1.58991 WP_001117767.1.58998 WP_001117767.1.5901 WP_001117767.1.59011 WP_001117767.1.59014 WP_001117767.1.59039 WP_001117767.1.5904 WP_001117767.1.59046 WP_001117767.1.59062 WP_001117767.1.59077 WP_001117767.1.59098 WP_001117767.1.59124 WP_001117767.1.59133 WP_001117767.1.59135 WP_001117767.1.59146 WP_001117767.1.59178 WP_001117767.1.59187 WP_001117767.1.5920 WP_001117767.1.59203 WP_001117767.1.59213 WP_001117767.1.5925 WP_001117767.1.59269 WP_001117767.1.59284 WP_001117767.1.59311 WP_001117767.1.59327 WP_001117767.1.59329 WP_001117767.1.59334 WP_001117767.1.59363 WP_001117767.1.5938 WP_001117767.1.59380 WP_001117767.1.59397 WP_001117767.1.59398 WP_001117767.1.5940 WP_001117767.1.59401 WP_001117767.1.59404 WP_001117767.1.59414 WP_001117767.1.59441 WP_001117767.1.59457 WP_001117767.1.59459 WP_001117767.1.59462 WP_001117767.1.59464 WP_001117767.1.59467 WP_001117767.1.59478 WP_001117767.1.59489 WP_001117767.1.59498 WP_001117767.1.59540 WP_001117767.1.59546 WP_001117767.1.59547 WP_001117767.1.59594 WP_001117767.1.59598 WP_001117767.1.59603 WP_001117767.1.59609 WP_001117767.1.59624 WP_001117767.1.59629 WP_001117767.1.59643 WP_001117767.1.59663 WP_001117767.1.59668 WP_001117767.1.59669 WP_001117767.1.59671 WP_001117767.1.59697 WP_001117767.1.5972 WP_001117767.1.59736 WP_001117767.1.59787 WP_001117767.1.59803 WP_001117767.1.59819 WP_001117767.1.5982 WP_001117767.1.59822 WP_001117767.1.59864 WP_001117767.1.59874 WP_001117767.1.59881 WP_001117767.1.59886 WP_001117767.1.59896 WP_001117767.1.59907 WP_001117767.1.59915 WP_001117767.1.59921 WP_001117767.1.59945 WP_001117767.1.59977 WP_001117767.1.60001 WP_001117767.1.60006 WP_001117767.1.60022 WP_001117767.1.6006 WP_001117767.1.60086 WP_001117767.1.60101 WP_001117767.1.60107 WP_001117767.1.6011 WP_001117767.1.60118 WP_001117767.1.60123 WP_001117767.1.60124 WP_001117767.1.60147 WP_001117767.1.60149 WP_001117767.1.60156 WP_001117767.1.60157 WP_001117767.1.60158 WP_001117767.1.6017 WP_001117767.1.60181 WP_001117767.1.60201 WP_001117767.1.60227 WP_001117767.1.60251 WP_001117767.1.60259 WP_001117767.1.60280 WP_001117767.1.60302 WP_001117767.1.60307 WP_001117767.1.60339 WP_001117767.1.6034 WP_001117767.1.60345 WP_001117767.1.60353 WP_001117767.1.60355 WP_001117767.1.60360 WP_001117767.1.60368 WP_001117767.1.60382 WP_001117767.1.60414 WP_001117767.1.60431 WP_001117767.1.60434 WP_001117767.1.60462 WP_001117767.1.60473 WP_001117767.1.60492 WP_001117767.1.60493 WP_001117767.1.60515 WP_001117767.1.60530 WP_001117767.1.60547 WP_001117767.1.60551 WP_001117767.1.60585 WP_001117767.1.60594 WP_001117767.1.60595 WP_001117767.1.60636 WP_001117767.1.60641 WP_001117767.1.60675 WP_001117767.1.60677 WP_001117767.1.60690 WP_001117767.1.60696 WP_001117767.1.60719 WP_001117767.1.60730 WP_001117767.1.60734 WP_001117767.1.60742 WP_001117767.1.60750 WP_001117767.1.60751 WP_001117767.1.60758 WP_001117767.1.60759 WP_001117767.1.60765 WP_001117767.1.60778 WP_001117767.1.60787 WP_001117767.1.60820 WP_001117767.1.60845 WP_001117767.1.6085 WP_001117767.1.60859 WP_001117767.1.60869 WP_001117767.1.60888 WP_001117767.1.60898 WP_001117767.1.60912 WP_001117767.1.60917 WP_001117767.1.60923 WP_001117767.1.60934 WP_001117767.1.60939 WP_001117767.1.60943 WP_001117767.1.60946 WP_001117767.1.60948 WP_001117767.1.60949 WP_001117767.1.60965 WP_001117767.1.60982 WP_001117767.1.60991 WP_001117767.1.61009 WP_001117767.1.61013 WP_001117767.1.61019 WP_001117767.1.61023 WP_001117767.1.61026 WP_001117767.1.61029 WP_001117767.1.61030 WP_001117767.1.61031 WP_001117767.1.61077 WP_001117767.1.61082 WP_001117767.1.61107 WP_001117767.1.61115 WP_001117767.1.61119 WP_001117767.1.61139 WP_001117767.1.61153 WP_001117767.1.6118 WP_001117767.1.61187 WP_001117767.1.61188 WP_001117767.1.61189 WP_001117767.1.6119 WP_001117767.1.61215 WP_001117767.1.61224 WP_001117767.1.6123 WP_001117767.1.61257 WP_001117767.1.61261 WP_001117767.1.61263 WP_001117767.1.61271 WP_001117767.1.61277 WP_001117767.1.61286 WP_001117767.1.61313 WP_001117767.1.61316 WP_001117767.1.61318 WP_001117767.1.61324 WP_001117767.1.61327 WP_001117767.1.61339 WP_001117767.1.61346 WP_001117767.1.61353 WP_001117767.1.6136 WP_001117767.1.61375 WP_001117767.1.61393 WP_001117767.1.61394 WP_001117767.1.61408 WP_001117767.1.61421 WP_001117767.1.61430 WP_001117767.1.61439 WP_001117767.1.61440 WP_001117767.1.6149 WP_001117767.1.61515 WP_001117767.1.61547 WP_001117767.1.61555 WP_001117767.1.61564 WP_001117767.1.61585 WP_001117767.1.61591 WP_001117767.1.61597 WP_001117767.1.61615 WP_001117767.1.61639 WP_001117767.1.61641 WP_001117767.1.61653 WP_001117767.1.6166 WP_001117767.1.61687 WP_001117767.1.6170 WP_001117767.1.61705 WP_001117767.1.61709 WP_001117767.1.61713 WP_001117767.1.61747 WP_001117767.1.61749 WP_001117767.1.61776 WP_001117767.1.61784 WP_001117767.1.61800 WP_001117767.1.61802 WP_001117767.1.61831 WP_001117767.1.61838 WP_001117767.1.61843 WP_001117767.1.61864 WP_001117767.1.6188 WP_001117767.1.6189 WP_001117767.1.61897 WP_001117767.1.619 WP_001117767.1.61903 WP_001117767.1.61910 WP_001117767.1.61921 WP_001117767.1.61936 WP_001117767.1.61962 WP_001117767.1.61970 WP_001117767.1.61975 WP_001117767.1.61976 WP_001117767.1.61978 WP_001117767.1.62002 WP_001117767.1.6201 WP_001117767.1.62028 WP_001117767.1.62030 WP_001117767.1.62069 WP_001117767.1.62071 WP_001117767.1.6208 WP_001117767.1.62084 WP_001117767.1.62085 WP_001117767.1.62088 WP_001117767.1.62093 WP_001117767.1.62096 WP_001117767.1.62127 WP_001117767.1.62140 WP_001117767.1.62160 WP_001117767.1.62164 WP_001117767.1.62229 WP_001117767.1.62247 WP_001117767.1.62253 WP_001117767.1.62254 WP_001117767.1.62265 WP_001117767.1.62318 WP_001117767.1.6234 WP_001117767.1.62346 WP_001117767.1.62352 WP_001117767.1.62367 WP_001117767.1.62382 WP_001117767.1.62383 WP_001117767.1.62392 WP_001117767.1.62398 WP_001117767.1.62409 WP_001117767.1.62414 WP_001117767.1.62429 WP_001117767.1.62437 WP_001117767.1.62453 WP_001117767.1.62459 WP_001117767.1.62462 WP_001117767.1.62474 WP_001117767.1.62482 WP_001117767.1.62492 WP_001117767.1.62496 WP_001117767.1.6250 WP_001117767.1.62537 WP_001117767.1.62539 WP_001117767.1.62553 WP_001117767.1.62563 WP_001117767.1.62575 WP_001117767.1.62602 WP_001117767.1.62608 WP_001117767.1.62621 WP_001117767.1.62625 WP_001117767.1.62630 WP_001117767.1.62653 WP_001117767.1.6266 WP_001117767.1.62671 WP_001117767.1.62674 WP_001117767.1.6268 WP_001117767.1.62684 WP_001117767.1.62685 WP_001117767.1.62723 WP_001117767.1.62740 WP_001117767.1.62764 WP_001117767.1.62771 WP_001117767.1.62796 WP_001117767.1.62808 WP_001117767.1.62822 WP_001117767.1.62824 WP_001117767.1.62829 WP_001117767.1.62831 WP_001117767.1.62842 WP_001117767.1.62860 WP_001117767.1.62863 WP_001117767.1.62878 WP_001117767.1.62880 WP_001117767.1.62925 WP_001117767.1.62927 WP_001117767.1.62956 WP_001117767.1.62970 WP_001117767.1.62974 WP_001117767.1.6298 WP_001117767.1.62998 WP_001117767.1.63003 WP_001117767.1.63004 WP_001117767.1.63011 WP_001117767.1.63021 WP_001117767.1.63027 WP_001117767.1.63040 WP_001117767.1.63050 WP_001117767.1.63062 WP_001117767.1.63068 WP_001117767.1.63070 WP_001117767.1.63083 WP_001117767.1.63085 WP_001117767.1.631 WP_001117767.1.63107 WP_001117767.1.63131 WP_001117767.1.63132 WP_001117767.1.63139 WP_001117767.1.63140 WP_001117767.1.63142 WP_001117767.1.63162 WP_001117767.1.63170 WP_001117767.1.63182 WP_001117767.1.63195 WP_001117767.1.63215 WP_001117767.1.63220 WP_001117767.1.63244 WP_001117767.1.63255 WP_001117767.1.63266 WP_001117767.1.63273 WP_001117767.1.63279 WP_001117767.1.63280 WP_001117767.1.63288 WP_001117767.1.63289 WP_001117767.1.63296 WP_001117767.1.63304 WP_001117767.1.63307 WP_001117767.1.63313 WP_001117767.1.63319 WP_001117767.1.63324 WP_001117767.1.63333 WP_001117767.1.63335 WP_001117767.1.63337 WP_001117767.1.63341 WP_001117767.1.63364 WP_001117767.1.63365 WP_001117767.1.63406 WP_001117767.1.63421 WP_001117767.1.63441 WP_001117767.1.63460 WP_001117767.1.63469 WP_001117767.1.63471 WP_001117767.1.63510 WP_001117767.1.63527 WP_001117767.1.63540 WP_001117767.1.6355 WP_001117767.1.63565 WP_001117767.1.63589 WP_001117767.1.63617 WP_001117767.1.63635 WP_001117767.1.63672 WP_001117767.1.63673 WP_001117767.1.63678 WP_001117767.1.63693 WP_001117767.1.63704 WP_001117767.1.63705 WP_001117767.1.63726 WP_001117767.1.63729 WP_001117767.1.6374 WP_001117767.1.63751 WP_001117767.1.63759 WP_001117767.1.63760 WP_001117767.1.63763 WP_001117767.1.63774 WP_001117767.1.6378 WP_001117767.1.63828 WP_001117767.1.63847 WP_001117767.1.63874 WP_001117767.1.6388 WP_001117767.1.63890 WP_001117767.1.63894 WP_001117767.1.63895 WP_001117767.1.63907 WP_001117767.1.63910 WP_001117767.1.63937 WP_001117767.1.63947 WP_001117767.1.63975 WP_001117767.1.63978 WP_001117767.1.63987 WP_001117767.1.63998 WP_001117767.1.64012 WP_001117767.1.6403 WP_001117767.1.64060 WP_001117767.1.6408 WP_001117767.1.64094 WP_001117767.1.64105 WP_001117767.1.64108 WP_001117767.1.6412 WP_001117767.1.64127 WP_001117767.1.64181 WP_001117767.1.64192 WP_001117767.1.64207 WP_001117767.1.64230 WP_001117767.1.64232 WP_001117767.1.64250 WP_001117767.1.64251 WP_001117767.1.64279 WP_001117767.1.64288 WP_001117767.1.64303 WP_001117767.1.64304 WP_001117767.1.64334 WP_001117767.1.64351 WP_001117767.1.64367 WP_001117767.1.64368 WP_001117767.1.6438 WP_001117767.1.64397 WP_001117767.1.64400 WP_001117767.1.64408 WP_001117767.1.64434 WP_001117767.1.64440 WP_001117767.1.64446 WP_001117767.1.64456 WP_001117767.1.64457 WP_001117767.1.64473 WP_001117767.1.645 WP_001117767.1.64525 WP_001117767.1.6453 WP_001117767.1.64537 WP_001117767.1.64549 WP_001117767.1.64565 WP_001117767.1.64583 WP_001117767.1.6459 WP_001117767.1.6462 WP_001117767.1.64630 WP_001117767.1.64631 WP_001117767.1.64665 WP_001117767.1.64677 WP_001117767.1.64686 WP_001117767.1.64720 WP_001117767.1.64765 WP_001117767.1.6479 WP_001117767.1.64811 WP_001117767.1.64845 WP_001117767.1.64858 WP_001117767.1.64860 WP_001117767.1.64873 WP_001117767.1.64879 WP_001117767.1.6488 WP_001117767.1.64893 WP_001117767.1.64896 WP_001117767.1.64897 WP_001117767.1.64899 WP_001117767.1.64911 WP_001117767.1.64928 WP_001117767.1.64935 WP_001117767.1.64951 WP_001117767.1.64961 WP_001117767.1.64994 WP_001117767.1.64996 WP_001117767.1.65025 WP_001117767.1.65033 WP_001117767.1.65038 WP_001117767.1.65044 WP_001117767.1.65046 WP_001117767.1.65076 WP_001117767.1.65082 WP_001117767.1.6509 WP_001117767.1.65125 WP_001117767.1.65132 WP_001117767.1.65153 WP_001117767.1.65156 WP_001117767.1.65158 WP_001117767.1.65164 WP_001117767.1.65180 WP_001117767.1.65193 WP_001117767.1.65203 WP_001117767.1.65214 WP_001117767.1.65217 WP_001117767.1.65233 WP_001117767.1.65243 WP_001117767.1.65259 WP_001117767.1.65274 WP_001117767.1.6531 WP_001117767.1.65317 WP_001117767.1.65361 WP_001117767.1.65367 WP_001117767.1.65387 WP_001117767.1.65406 WP_001117767.1.65419 WP_001117767.1.65423 WP_001117767.1.65432 WP_001117767.1.6544 WP_001117767.1.65443 WP_001117767.1.65448 WP_001117767.1.65451 WP_001117767.1.6547 WP_001117767.1.65470 WP_001117767.1.65504 WP_001117767.1.6551 WP_001117767.1.65520 WP_001117767.1.65541 WP_001117767.1.65544 WP_001117767.1.65555 WP_001117767.1.65562 WP_001117767.1.65585 WP_001117767.1.65599 WP_001117767.1.65600 WP_001117767.1.65616 WP_001117767.1.65629 WP_001117767.1.65643 WP_001117767.1.65653 WP_001117767.1.65656 WP_001117767.1.65663 WP_001117767.1.65675 WP_001117767.1.6568 WP_001117767.1.65689 WP_001117767.1.65693 WP_001117767.1.65700 WP_001117767.1.65703 WP_001117767.1.65704 WP_001117767.1.65705 WP_001117767.1.65713 WP_001117767.1.65717 WP_001117767.1.65734 WP_001117767.1.65750 WP_001117767.1.65752 WP_001117767.1.65769 WP_001117767.1.6578 WP_001117767.1.65808 WP_001117767.1.65809 WP_001117767.1.65842 WP_001117767.1.6585 WP_001117767.1.65856 WP_001117767.1.65886 WP_001117767.1.65892 WP_001117767.1.65922 WP_001117767.1.65928 WP_001117767.1.65931 WP_001117767.1.65935 WP_001117767.1.65947 WP_001117767.1.65965 WP_001117767.1.65990 WP_001117767.1.66009 WP_001117767.1.66014 WP_001117767.1.6603 WP_001117767.1.66035 WP_001117767.1.66054 WP_001117767.1.66056 WP_001117767.1.66069 WP_001117767.1.66073 WP_001117767.1.66081 WP_001117767.1.661 WP_001117767.1.6612 WP_001117767.1.66120 WP_001117767.1.66130 WP_001117767.1.66133 WP_001117767.1.66144 WP_001117767.1.66175 WP_001117767.1.66227 WP_001117767.1.66262 WP_001117767.1.66265 WP_001117767.1.66281 WP_001117767.1.66287 WP_001117767.1.66298 WP_001117767.1.66302 WP_001117767.1.6632 WP_001117767.1.66322 WP_001117767.1.66328 WP_001117767.1.66366 WP_001117767.1.66369 WP_001117767.1.66433 WP_001117767.1.66453 WP_001117767.1.66505 WP_001117767.1.66513 WP_001117767.1.66518 WP_001117767.1.66519 WP_001117767.1.66542 WP_001117767.1.66554 WP_001117767.1.66556 WP_001117767.1.66564 WP_001117767.1.66576 WP_001117767.1.66588 WP_001117767.1.66598 WP_001117767.1.66601 WP_001117767.1.66606 WP_001117767.1.66611 WP_001117767.1.66614 WP_001117767.1.66645 WP_001117767.1.66655 WP_001117767.1.66664 WP_001117767.1.66677 WP_001117767.1.6668 WP_001117767.1.66690 WP_001117767.1.66705 WP_001117767.1.66711 WP_001117767.1.66712 WP_001117767.1.66726 WP_001117767.1.6674 WP_001117767.1.66766 WP_001117767.1.66786 WP_001117767.1.66792 WP_001117767.1.66803 WP_001117767.1.66816 WP_001117767.1.66818 WP_001117767.1.6684 WP_001117767.1.66853 WP_001117767.1.66879 WP_001117767.1.6688 WP_001117767.1.66904 WP_001117767.1.66906 WP_001117767.1.66938 WP_001117767.1.66969 WP_001117767.1.66979 WP_001117767.1.6700 WP_001117767.1.67006 WP_001117767.1.67012 WP_001117767.1.67014 WP_001117767.1.67016 WP_001117767.1.67067 WP_001117767.1.67072 WP_001117767.1.67090 WP_001117767.1.67112 WP_001117767.1.67113 WP_001117767.1.67135 WP_001117767.1.67152 WP_001117767.1.67155 WP_001117767.1.67160 WP_001117767.1.67191 WP_001117767.1.67204 WP_001117767.1.6722 WP_001117767.1.67238 WP_001117767.1.67251 WP_001117767.1.67259 WP_001117767.1.6726 WP_001117767.1.67266 WP_001117767.1.67286 WP_001117767.1.67294 WP_001117767.1.67296 WP_001117767.1.67297 WP_001117767.1.67312 WP_001117767.1.67328 WP_001117767.1.67329 WP_001117767.1.67333 WP_001117767.1.67375 WP_001117767.1.67379 WP_001117767.1.67384 WP_001117767.1.67386 WP_001117767.1.6740 WP_001117767.1.67414 WP_001117767.1.67418 WP_001117767.1.67420 WP_001117767.1.67425 WP_001117767.1.67447 WP_001117767.1.67457 WP_001117767.1.67463 WP_001117767.1.67480 WP_001117767.1.67505 WP_001117767.1.67507 WP_001117767.1.67513 WP_001117767.1.67520 WP_001117767.1.67521 WP_001117767.1.67540 WP_001117767.1.67554 WP_001117767.1.67571 WP_001117767.1.67572 WP_001117767.1.67609 WP_001117767.1.67612 WP_001117767.1.67618 WP_001117767.1.67620 WP_001117767.1.67621 WP_001117767.1.67632 WP_001117767.1.67644 WP_001117767.1.67651 WP_001117767.1.67653 WP_001117767.1.67691 WP_001117767.1.67703 WP_001117767.1.67712 WP_001117767.1.67713 WP_001117767.1.67722 WP_001117767.1.67752 WP_001117767.1.67754 WP_001117767.1.67762 WP_001117767.1.67767 WP_001117767.1.67798 WP_001117767.1.67800 WP_001117767.1.67808 WP_001117767.1.67815 WP_001117767.1.67834 WP_001117767.1.6786 WP_001117767.1.67865 WP_001117767.1.67867 WP_001117767.1.67880 WP_001117767.1.67889 WP_001117767.1.67900 WP_001117767.1.67925 WP_001117767.1.67931 WP_001117767.1.67941 WP_001117767.1.67986 WP_001117767.1.67991 WP_001117767.1.68001 WP_001117767.1.68020 WP_001117767.1.68033 WP_001117767.1.68054 WP_001117767.1.68066 WP_001117767.1.68101 WP_001117767.1.68102 WP_001117767.1.6811 WP_001117767.1.68111 WP_001117767.1.68134 WP_001117767.1.68139 WP_001117767.1.68141 WP_001117767.1.68152 WP_001117767.1.68160 WP_001117767.1.68161 WP_001117767.1.68199 WP_001117767.1.68202 WP_001117767.1.68219 WP_001117767.1.68221 WP_001117767.1.68223 WP_001117767.1.68233 WP_001117767.1.6824 WP_001117767.1.68261 WP_001117767.1.68268 WP_001117767.1.68286 WP_001117767.1.68295 WP_001117767.1.68296 WP_001117767.1.68299 WP_001117767.1.6830 WP_001117767.1.68307 WP_001117767.1.68334 WP_001117767.1.6834 WP_001117767.1.68343 WP_001117767.1.68351 WP_001117767.1.68355 WP_001117767.1.68366 WP_001117767.1.68367 WP_001117767.1.6839 WP_001117767.1.68392 WP_001117767.1.68397 WP_001117767.1.68398 WP_001117767.1.68399 WP_001117767.1.68404 WP_001117767.1.68416 WP_001117767.1.68425 WP_001117767.1.68476 WP_001117767.1.68479 WP_001117767.1.68483 WP_001117767.1.68489 WP_001117767.1.68504 WP_001117767.1.68505 WP_001117767.1.68522 WP_001117767.1.68542 WP_001117767.1.68548 WP_001117767.1.68565 WP_001117767.1.68575 WP_001117767.1.686 WP_001117767.1.68636 WP_001117767.1.68650 WP_001117767.1.68657 WP_001117767.1.68681 WP_001117767.1.68683 WP_001117767.1.68699 WP_001117767.1.68703 WP_001117767.1.68728 WP_001117767.1.68737 WP_001117767.1.68741 WP_001117767.1.68743 WP_001117767.1.68747 WP_001117767.1.68773 WP_001117767.1.68775 WP_001117767.1.68813 WP_001117767.1.68831 WP_001117767.1.68854 WP_001117767.1.68864 WP_001117767.1.68875 WP_001117767.1.68883 WP_001117767.1.68917 WP_001117767.1.68931 WP_001117767.1.68943 WP_001117767.1.68944 WP_001117767.1.69012 WP_001117767.1.69016 WP_001117767.1.69045 WP_001117767.1.69071 WP_001117767.1.69078 WP_001117767.1.69087 WP_001117767.1.69089 WP_001117767.1.691 WP_001117767.1.69105 WP_001117767.1.69110 WP_001117767.1.69111 WP_001117767.1.69120 WP_001117767.1.69125 WP_001117767.1.69147 WP_001117767.1.6915 WP_001117767.1.69162 WP_001117767.1.6917 WP_001117767.1.69179 WP_001117767.1.69191 WP_001117767.1.69198 WP_001117767.1.69213 WP_001117767.1.69219 WP_001117767.1.69222 WP_001117767.1.69232 WP_001117767.1.69237 WP_001117767.1.69239 WP_001117767.1.69251 WP_001117767.1.69280 WP_001117767.1.69314 WP_001117767.1.69349 WP_001117767.1.69361 WP_001117767.1.69366 WP_001117767.1.69378 WP_001117767.1.69394 WP_001117767.1.69395 WP_001117767.1.69412 WP_001117767.1.69415 WP_001117767.1.69434 WP_001117767.1.69437 WP_001117767.1.69446 WP_001117767.1.69475 WP_001117767.1.69476 WP_001117767.1.69477 WP_001117767.1.69480 WP_001117767.1.69483 WP_001117767.1.69484 WP_001117767.1.69489 WP_001117767.1.695 WP_001117767.1.69520 WP_001117767.1.6953 WP_001117767.1.69546 WP_001117767.1.69552 WP_001117767.1.69559 WP_001117767.1.69563 WP_001117767.1.69598 WP_001117767.1.69622 WP_001117767.1.69639 WP_001117767.1.69679 WP_001117767.1.6968 WP_001117767.1.69683 WP_001117767.1.69685 WP_001117767.1.69718 WP_001117767.1.69721 WP_001117767.1.69724 WP_001117767.1.6980 WP_001117767.1.69820 WP_001117767.1.69823 WP_001117767.1.69830 WP_001117767.1.69842 WP_001117767.1.69877 WP_001117767.1.69878 WP_001117767.1.69882 WP_001117767.1.699 WP_001117767.1.69902 WP_001117767.1.69921 WP_001117767.1.69934 WP_001117767.1.69980 WP_001117767.1.69987 WP_001117767.1.69995 WP_001117767.1.70024 WP_001117767.1.70048 WP_001117767.1.70089 WP_001117767.1.70105 WP_001117767.1.7012 WP_001117767.1.70133 WP_001117767.1.70161 WP_001117767.1.70210 WP_001117767.1.70220 WP_001117767.1.70225 WP_001117767.1.70228 WP_001117767.1.7024 WP_001117767.1.70253 WP_001117767.1.70266 WP_001117767.1.70273 WP_001117767.1.70294 WP_001117767.1.703 WP_001117767.1.7030 WP_001117767.1.70311 WP_001117767.1.70313 WP_001117767.1.70334 WP_001117767.1.70338 WP_001117767.1.7034 WP_001117767.1.70344 WP_001117767.1.70349 WP_001117767.1.70353 WP_001117767.1.70361 WP_001117767.1.70389 WP_001117767.1.7043 WP_001117767.1.70438 WP_001117767.1.70448 WP_001117767.1.70451 WP_001117767.1.70457 WP_001117767.1.70459 WP_001117767.1.7046 WP_001117767.1.70462 WP_001117767.1.70487 WP_001117767.1.70495 WP_001117767.1.70527 WP_001117767.1.7053 WP_001117767.1.70541 WP_001117767.1.70546 WP_001117767.1.70554 WP_001117767.1.70564 WP_001117767.1.70572 WP_001117767.1.7061 WP_001117767.1.70611 WP_001117767.1.70635 WP_001117767.1.7064 WP_001117767.1.70641 WP_001117767.1.70651 WP_001117767.1.7067 WP_001117767.1.70672 WP_001117767.1.707 WP_001117767.1.7071 WP_001117767.1.70721 WP_001117767.1.7073 WP_001117767.1.70763 WP_001117767.1.70790 WP_001117767.1.70791 WP_001117767.1.70808 WP_001117767.1.70818 WP_001117767.1.70823 WP_001117767.1.70829 WP_001117767.1.70835 WP_001117767.1.70843 WP_001117767.1.70850 WP_001117767.1.70855 WP_001117767.1.7089 WP_001117767.1.70909 WP_001117767.1.70917 WP_001117767.1.70924 WP_001117767.1.70926 WP_001117767.1.70930 WP_001117767.1.70939 WP_001117767.1.70943 WP_001117767.1.70994 WP_001117767.1.710 WP_001117767.1.71016 WP_001117767.1.71027 WP_001117767.1.71043 WP_001117767.1.7105 WP_001117767.1.71058 WP_001117767.1.71059 WP_001117767.1.71073 WP_001117767.1.7109 WP_001117767.1.711 WP_001117767.1.71130 WP_001117767.1.71143 WP_001117767.1.71179 WP_001117767.1.71180 WP_001117767.1.71182 WP_001117767.1.71196 WP_001117767.1.7120 WP_001117767.1.71208 WP_001117767.1.71231 WP_001117767.1.71236 WP_001117767.1.7125 WP_001117767.1.71256 WP_001117767.1.71257 WP_001117767.1.71266 WP_001117767.1.71267 WP_001117767.1.71280 WP_001117767.1.71295 WP_001117767.1.71298 WP_001117767.1.71301 WP_001117767.1.71313 WP_001117767.1.71325 WP_001117767.1.71332 WP_001117767.1.71345 WP_001117767.1.71351 WP_001117767.1.71359 WP_001117767.1.71404 WP_001117767.1.71410 WP_001117767.1.71416 WP_001117767.1.71419 WP_001117767.1.71428 WP_001117767.1.71431 WP_001117767.1.71438 WP_001117767.1.71463 WP_001117767.1.71466 WP_001117767.1.71467 WP_001117767.1.71475 WP_001117767.1.71483 WP_001117767.1.7150 WP_001117767.1.71519 WP_001117767.1.71521 WP_001117767.1.71529 WP_001117767.1.71541 WP_001117767.1.71543 WP_001117767.1.71547 WP_001117767.1.71572 WP_001117767.1.71575 WP_001117767.1.7158 WP_001117767.1.71590 WP_001117767.1.71596 WP_001117767.1.71602 WP_001117767.1.7161 WP_001117767.1.71644 WP_001117767.1.71662 WP_001117767.1.71676 WP_001117767.1.71715 WP_001117767.1.71735 WP_001117767.1.71737 WP_001117767.1.71741 WP_001117767.1.71771 WP_001117767.1.71772 WP_001117767.1.71780 WP_001117767.1.71788 WP_001117767.1.7179 WP_001117767.1.71800 WP_001117767.1.71828 WP_001117767.1.71836 WP_001117767.1.71859 WP_001117767.1.71861 WP_001117767.1.71877 WP_001117767.1.71888 WP_001117767.1.71892 WP_001117767.1.71910 WP_001117767.1.71925 WP_001117767.1.71949 WP_001117767.1.71978 WP_001117767.1.7198 WP_001117767.1.71981 WP_001117767.1.71989 WP_001117767.1.72002 WP_001117767.1.72018 WP_001117767.1.72026 WP_001117767.1.72031 WP_001117767.1.72035 WP_001117767.1.72067 WP_001117767.1.72085 WP_001117767.1.72089 WP_001117767.1.72099 WP_001117767.1.72112 WP_001117767.1.72148 WP_001117767.1.72169 WP_001117767.1.72176 WP_001117767.1.72205 WP_001117767.1.72224 WP_001117767.1.72257 WP_001117767.1.72271 WP_001117767.1.72306 WP_001117767.1.72315 WP_001117767.1.72330 WP_001117767.1.72347 WP_001117767.1.7236 WP_001117767.1.72363 WP_001117767.1.72366 WP_001117767.1.72371 WP_001117767.1.7242 WP_001117767.1.72424 WP_001117767.1.72433 WP_001117767.1.72465 WP_001117767.1.72478 WP_001117767.1.72489 WP_001117767.1.72497 WP_001117767.1.72529 WP_001117767.1.72547 WP_001117767.1.72564 WP_001117767.1.7258 WP_001117767.1.7260 WP_001117767.1.72649 WP_001117767.1.72654 WP_001117767.1.72666 WP_001117767.1.72708 WP_001117767.1.72719 WP_001117767.1.72750 WP_001117767.1.72753 WP_001117767.1.72760 WP_001117767.1.72762 WP_001117767.1.7278 WP_001117767.1.72787 WP_001117767.1.72816 WP_001117767.1.72832 WP_001117767.1.72834 WP_001117767.1.72835 WP_001117767.1.72874 WP_001117767.1.72881 WP_001117767.1.72903 WP_001117767.1.72904 WP_001117767.1.7292 WP_001117767.1.72935 WP_001117767.1.7294 WP_001117767.1.72945 WP_001117767.1.72961 WP_001117767.1.72965 WP_001117767.1.72991 WP_001117767.1.73004 WP_001117767.1.73017 WP_001117767.1.73019 WP_001117767.1.73021 WP_001117767.1.73022 WP_001117767.1.73037 WP_001117767.1.73074 WP_001117767.1.73087 WP_001117767.1.73122 WP_001117767.1.73132 WP_001117767.1.73140 WP_001117767.1.73195 WP_001117767.1.73201 WP_001117767.1.73211 WP_001117767.1.73240 WP_001117767.1.73241 WP_001117767.1.73246 WP_001117767.1.73264 WP_001117767.1.73265 WP_001117767.1.73286 WP_001117767.1.73312 WP_001117767.1.73386 WP_001117767.1.73401 WP_001117767.1.73402 WP_001117767.1.73420 WP_001117767.1.73444 WP_001117767.1.73450 WP_001117767.1.73456 WP_001117767.1.73464 WP_001117767.1.73467 WP_001117767.1.73489 WP_001117767.1.73501 WP_001117767.1.73513 WP_001117767.1.73526 WP_001117767.1.73536 WP_001117767.1.73539 WP_001117767.1.73547 WP_001117767.1.73571 WP_001117767.1.73591 WP_001117767.1.736 WP_001117767.1.73610 WP_001117767.1.73639 WP_001117767.1.73640 WP_001117767.1.7365 WP_001117767.1.73674 WP_001117767.1.73685 WP_001117767.1.73687 WP_001117767.1.73693 WP_001117767.1.73694 WP_001117767.1.73733 WP_001117767.1.73735 WP_001117767.1.73736 WP_001117767.1.73740 WP_001117767.1.73759 WP_001117767.1.73786 WP_001117767.1.73789 WP_001117767.1.7380 WP_001117767.1.73834 WP_001117767.1.73837 WP_001117767.1.73858 WP_001117767.1.73868 WP_001117767.1.73880 WP_001117767.1.73885 WP_001117767.1.73900 WP_001117767.1.73902 WP_001117767.1.73910 WP_001117767.1.73920 WP_001117767.1.73921 WP_001117767.1.73940 WP_001117767.1.73949 WP_001117767.1.73961 WP_001117767.1.73969 WP_001117767.1.73971 WP_001117767.1.73976 WP_001117767.1.73983 WP_001117767.1.74004 WP_001117767.1.74006 WP_001117767.1.7401 WP_001117767.1.74010 WP_001117767.1.74013 WP_001117767.1.74025 WP_001117767.1.74027 WP_001117767.1.7406 WP_001117767.1.74073 WP_001117767.1.74081 WP_001117767.1.74085 WP_001117767.1.74155 WP_001117767.1.74157 WP_001117767.1.74158 WP_001117767.1.74161 WP_001117767.1.74172 WP_001117767.1.74173 WP_001117767.1.7418 WP_001117767.1.74183 WP_001117767.1.74187 WP_001117767.1.74201 WP_001117767.1.74216 WP_001117767.1.74234 WP_001117767.1.74237 WP_001117767.1.74242 WP_001117767.1.74257 WP_001117767.1.7427 WP_001117767.1.74273 WP_001117767.1.7428 WP_001117767.1.74284 WP_001117767.1.74295 WP_001117767.1.74327 WP_001117767.1.74338 WP_001117767.1.7434 WP_001117767.1.74353 WP_001117767.1.74356 WP_001117767.1.74380 WP_001117767.1.74429 WP_001117767.1.74456 WP_001117767.1.74457 WP_001117767.1.74468 WP_001117767.1.74486 WP_001117767.1.74556 WP_001117767.1.7457 WP_001117767.1.74576 WP_001117767.1.74587 WP_001117767.1.74610 WP_001117767.1.74638 WP_001117767.1.74681 WP_001117767.1.74693 WP_001117767.1.74696 WP_001117767.1.74704 WP_001117767.1.74731 WP_001117767.1.74747 WP_001117767.1.74758 WP_001117767.1.74761 WP_001117767.1.74770 WP_001117767.1.74781 WP_001117767.1.74785 WP_001117767.1.74797 WP_001117767.1.74802 WP_001117767.1.7482 WP_001117767.1.74840 WP_001117767.1.74846 WP_001117767.1.74849 WP_001117767.1.74866 WP_001117767.1.74874 WP_001117767.1.74890 WP_001117767.1.74899 WP_001117767.1.74911 WP_001117767.1.74922 WP_001117767.1.74924 WP_001117767.1.74961 WP_001117767.1.74963 WP_001117767.1.74978 WP_001117767.1.74985 WP_001117767.1.74994 WP_001117767.1.74999 WP_001117767.1.7500 WP_001117767.1.75006 WP_001117767.1.75038 WP_001117767.1.75044 WP_001117767.1.75048 WP_001117767.1.75052 WP_001117767.1.75070 WP_001117767.1.75091 WP_001117767.1.75093 WP_001117767.1.75111 WP_001117767.1.75122 WP_001117767.1.75127 WP_001117767.1.75131 WP_001117767.1.75132 WP_001117767.1.75141 WP_001117767.1.75186 WP_001117767.1.75227 WP_001117767.1.75252 WP_001117767.1.75253 WP_001117767.1.75294 WP_001117767.1.75298 WP_001117767.1.75320 WP_001117767.1.75323 WP_001117767.1.75327 WP_001117767.1.75349 WP_001117767.1.75351 WP_001117767.1.75356 WP_001117767.1.75365 WP_001117767.1.75375 WP_001117767.1.75379 WP_001117767.1.75399 WP_001117767.1.75409 WP_001117767.1.75411 WP_001117767.1.7542 WP_001117767.1.75438 WP_001117767.1.75440 WP_001117767.1.75481 WP_001117767.1.75506 WP_001117767.1.75509 WP_001117767.1.75521 WP_001117767.1.75527 WP_001117767.1.75538 WP_001117767.1.75542 WP_001117767.1.75551 WP_001117767.1.75566 WP_001117767.1.75571 WP_001117767.1.75590 WP_001117767.1.7561 WP_001117767.1.75623 WP_001117767.1.75647 WP_001117767.1.75649 WP_001117767.1.75652 WP_001117767.1.75680 WP_001117767.1.75685 WP_001117767.1.75692 WP_001117767.1.75704 WP_001117767.1.75743 WP_001117767.1.75769 WP_001117767.1.75770 WP_001117767.1.75775 WP_001117767.1.758 WP_001117767.1.75805 WP_001117767.1.75809 WP_001117767.1.75824 WP_001117767.1.75830 WP_001117767.1.7584 WP_001117767.1.75840 WP_001117767.1.75848 WP_001117767.1.75851 WP_001117767.1.75862 WP_001117767.1.75879 WP_001117767.1.75881 WP_001117767.1.75885 WP_001117767.1.75910 WP_001117767.1.75929 WP_001117767.1.75944 WP_001117767.1.75952 WP_001117767.1.75956 WP_001117767.1.7596 WP_001117767.1.75969 WP_001117767.1.76010 WP_001117767.1.76013 WP_001117767.1.76015 WP_001117767.1.7602 WP_001117767.1.76047 WP_001117767.1.76049 WP_001117767.1.76050 WP_001117767.1.76053 WP_001117767.1.7607 WP_001117767.1.76071 WP_001117767.1.76073 WP_001117767.1.76095 WP_001117767.1.76104 WP_001117767.1.76111 WP_001117767.1.76112 WP_001117767.1.76114 WP_001117767.1.76121 WP_001117767.1.76123 WP_001117767.1.76136 WP_001117767.1.76143 WP_001117767.1.76149 WP_001117767.1.76153 WP_001117767.1.76179 WP_001117767.1.76185 WP_001117767.1.76230 WP_001117767.1.76234 WP_001117767.1.7624 WP_001117767.1.7625 WP_001117767.1.76258 WP_001117767.1.76261 WP_001117767.1.76282 WP_001117767.1.76283 WP_001117767.1.76294 WP_001117767.1.76313 WP_001117767.1.76323 WP_001117767.1.76332 WP_001117767.1.76333 WP_001117767.1.76337 WP_001117767.1.76351 WP_001117767.1.7638 WP_001117767.1.76411 WP_001117767.1.76419 WP_001117767.1.76420 WP_001117767.1.76421 WP_001117767.1.76424 WP_001117767.1.76426 WP_001117767.1.76431 WP_001117767.1.76463 WP_001117767.1.76482 WP_001117767.1.76497 WP_001117767.1.765 WP_001117767.1.76528 WP_001117767.1.7658 WP_001117767.1.76604 WP_001117767.1.76606 WP_001117767.1.76624 WP_001117767.1.76648 WP_001117767.1.76659 WP_001117767.1.76686 WP_001117767.1.76689 WP_001117767.1.76690 WP_001117767.1.76693 WP_001117767.1.76711 WP_001117767.1.76718 WP_001117767.1.7675 WP_001117767.1.76790 WP_001117767.1.76792 WP_001117767.1.76798 WP_001117767.1.768 WP_001117767.1.76803 WP_001117767.1.76820 WP_001117767.1.76825 WP_001117767.1.76829 WP_001117767.1.76839 WP_001117767.1.76845 WP_001117767.1.7686 WP_001117767.1.76867 WP_001117767.1.76869 WP_001117767.1.76878 WP_001117767.1.76895 WP_001117767.1.76897 WP_001117767.1.76920 WP_001117767.1.76921 WP_001117767.1.76937 WP_001117767.1.7694 WP_001117767.1.76944 WP_001117767.1.76952 WP_001117767.1.76998 WP_001117767.1.77013 WP_001117767.1.77020 WP_001117767.1.77027 WP_001117767.1.77031 WP_001117767.1.77041 WP_001117767.1.77043 WP_001117767.1.77050 WP_001117767.1.77060 WP_001117767.1.77062 WP_001117767.1.77072 WP_001117767.1.77112 WP_001117767.1.77137 WP_001117767.1.77144 WP_001117767.1.77145 WP_001117767.1.77190 WP_001117767.1.77203 WP_001117767.1.77229 WP_001117767.1.77256 WP_001117767.1.77259 WP_001117767.1.77297 WP_001117767.1.77298 WP_001117767.1.77305 WP_001117767.1.77315 WP_001117767.1.77331 WP_001117767.1.77346 WP_001117767.1.77354 WP_001117767.1.77359 WP_001117767.1.77388 WP_001117767.1.77416 WP_001117767.1.77426 WP_001117767.1.77446 WP_001117767.1.7745 WP_001117767.1.7746 WP_001117767.1.77460 WP_001117767.1.77485 WP_001117767.1.77489 WP_001117767.1.77497 WP_001117767.1.77498 WP_001117767.1.7752 WP_001117767.1.77520 WP_001117767.1.77532 WP_001117767.1.77533 WP_001117767.1.77536 WP_001117767.1.77572 WP_001117767.1.77583 WP_001117767.1.77603 WP_001117767.1.77606 WP_001117767.1.77650 WP_001117767.1.77674 WP_001117767.1.77733 WP_001117767.1.77735 WP_001117767.1.77738 WP_001117767.1.7774 WP_001117767.1.77743 WP_001117767.1.77745 WP_001117767.1.77763 WP_001117767.1.77791 WP_001117767.1.77805 WP_001117767.1.77818 WP_001117767.1.77822 WP_001117767.1.77827 WP_001117767.1.77832 WP_001117767.1.77848 WP_001117767.1.7785 WP_001117767.1.77858 WP_001117767.1.7786 WP_001117767.1.77860 WP_001117767.1.7787 WP_001117767.1.77882 WP_001117767.1.77883 WP_001117767.1.77896 WP_001117767.1.77908 WP_001117767.1.77915 WP_001117767.1.77922 WP_001117767.1.77930 WP_001117767.1.77986 WP_001117767.1.78002 WP_001117767.1.78038 WP_001117767.1.78050 WP_001117767.1.78054 WP_001117767.1.78082 WP_001117767.1.78091 WP_001117767.1.78095 WP_001117767.1.7810 WP_001117767.1.78126 WP_001117767.1.78164 WP_001117767.1.78173 WP_001117767.1.78179 WP_001117767.1.78185 WP_001117767.1.78189 WP_001117767.1.78194 WP_001117767.1.78207 WP_001117767.1.78208 WP_001117767.1.78252 WP_001117767.1.78254 WP_001117767.1.78257 WP_001117767.1.7827 WP_001117767.1.78304 WP_001117767.1.78311 WP_001117767.1.78324 WP_001117767.1.7833 WP_001117767.1.78330 WP_001117767.1.78332 WP_001117767.1.78365 WP_001117767.1.78371 WP_001117767.1.78392 WP_001117767.1.78404 WP_001117767.1.78434 WP_001117767.1.78436 WP_001117767.1.78458 WP_001117767.1.78470 WP_001117767.1.78489 WP_001117767.1.78494 WP_001117767.1.7850 WP_001117767.1.78513 WP_001117767.1.7853 WP_001117767.1.78550 WP_001117767.1.7857 WP_001117767.1.78573 WP_001117767.1.78582 WP_001117767.1.78585 WP_001117767.1.78592 WP_001117767.1.78596 WP_001117767.1.78598 WP_001117767.1.78604 WP_001117767.1.78625 WP_001117767.1.78633 WP_001117767.1.78638 WP_001117767.1.78653 WP_001117767.1.78667 WP_001117767.1.7868 WP_001117767.1.78685 WP_001117767.1.78708 WP_001117767.1.78728 WP_001117767.1.78731 WP_001117767.1.78736 WP_001117767.1.78763 WP_001117767.1.78785 WP_001117767.1.78803 WP_001117767.1.78816 WP_001117767.1.78819 WP_001117767.1.78841 WP_001117767.1.78872 WP_001117767.1.7888 WP_001117767.1.78897 WP_001117767.1.78920 WP_001117767.1.78934 WP_001117767.1.78937 WP_001117767.1.78946 WP_001117767.1.78978 WP_001117767.1.78983 WP_001117767.1.78985 WP_001117767.1.78991 WP_001117767.1.78995 WP_001117767.1.7900 WP_001117767.1.79006 WP_001117767.1.79037 WP_001117767.1.79038 WP_001117767.1.7905 WP_001117767.1.79051 WP_001117767.1.79059 WP_001117767.1.79085 WP_001117767.1.79110 WP_001117767.1.79114 WP_001117767.1.79131 WP_001117767.1.7914 WP_001117767.1.79143 WP_001117767.1.79156 WP_001117767.1.79170 WP_001117767.1.79178 WP_001117767.1.79192 WP_001117767.1.79197 WP_001117767.1.79208 WP_001117767.1.79223 WP_001117767.1.79227 WP_001117767.1.79244 WP_001117767.1.79270 WP_001117767.1.79275 WP_001117767.1.79285 WP_001117767.1.7931 WP_001117767.1.79310 WP_001117767.1.79314 WP_001117767.1.79320 WP_001117767.1.79322 WP_001117767.1.79332 WP_001117767.1.79334 WP_001117767.1.7934 WP_001117767.1.79341 WP_001117767.1.79367 WP_001117767.1.79374 WP_001117767.1.79400 WP_001117767.1.79402 WP_001117767.1.79436 WP_001117767.1.79452 WP_001117767.1.79461 WP_001117767.1.79473 WP_001117767.1.79476 WP_001117767.1.79487 WP_001117767.1.79539 WP_001117767.1.79543 WP_001117767.1.79552 WP_001117767.1.79556 WP_001117767.1.79626 WP_001117767.1.79627 WP_001117767.1.79638 WP_001117767.1.79646 WP_001117767.1.79662 WP_001117767.1.79664 WP_001117767.1.79672 WP_001117767.1.79676 WP_001117767.1.79677 WP_001117767.1.79706 WP_001117767.1.79731 WP_001117767.1.79737 WP_001117767.1.79763 WP_001117767.1.7981 WP_001117767.1.79810 WP_001117767.1.79815 WP_001117767.1.79822 WP_001117767.1.79831 WP_001117767.1.79834 WP_001117767.1.79837 WP_001117767.1.79854 WP_001117767.1.79855 WP_001117767.1.7989 WP_001117767.1.79896 WP_001117767.1.79904 WP_001117767.1.79911 WP_001117767.1.79919 WP_001117767.1.7992 WP_001117767.1.79941 WP_001117767.1.79949 WP_001117767.1.79961 WP_001117767.1.79971 WP_001117767.1.79991 WP_001117767.1.80000 WP_001117767.1.80009 WP_001117767.1.80013 WP_001117767.1.80029 WP_001117767.1.80032 WP_001117767.1.80034 WP_001117767.1.80042 WP_001117767.1.80079 WP_001117767.1.80086 WP_001117767.1.80109 WP_001117767.1.80119 WP_001117767.1.80120 WP_001117767.1.80122 WP_001117767.1.80124 WP_001117767.1.80127 WP_001117767.1.80146 WP_001117767.1.80147 WP_001117767.1.80152 WP_001117767.1.80159 WP_001117767.1.80178 WP_001117767.1.80181 WP_001117767.1.80184 WP_001117767.1.80203 WP_001117767.1.80244 WP_001117767.1.80274 WP_001117767.1.80286 WP_001117767.1.80287 WP_001117767.1.80290 WP_001117767.1.80297 WP_001117767.1.8030 WP_001117767.1.80303 WP_001117767.1.8031 WP_001117767.1.80316 WP_001117767.1.80317 WP_001117767.1.80318 WP_001117767.1.8035 WP_001117767.1.80358 WP_001117767.1.80378 WP_001117767.1.80389 WP_001117767.1.80393 WP_001117767.1.8040 WP_001117767.1.80407 WP_001117767.1.80414 WP_001117767.1.8043 WP_001117767.1.80434 WP_001117767.1.8045 WP_001117767.1.80472 WP_001117767.1.80482 WP_001117767.1.80521 WP_001117767.1.80530 WP_001117767.1.80582 WP_001117767.1.80647 WP_001117767.1.8065 WP_001117767.1.80653 WP_001117767.1.8066 WP_001117767.1.80687 WP_001117767.1.80734 WP_001117767.1.80745 WP_001117767.1.80761 WP_001117767.1.80762 WP_001117767.1.80763 WP_001117767.1.8077 WP_001117767.1.80781 WP_001117767.1.80786 WP_001117767.1.80793 WP_001117767.1.80801 WP_001117767.1.80828 WP_001117767.1.80833 WP_001117767.1.8084 WP_001117767.1.80845 WP_001117767.1.8085 WP_001117767.1.80872 WP_001117767.1.80899 WP_001117767.1.809 WP_001117767.1.80962 WP_001117767.1.80972 WP_001117767.1.80979 WP_001117767.1.80980 WP_001117767.1.81010 WP_001117767.1.81022 WP_001117767.1.81049 WP_001117767.1.81052 WP_001117767.1.81055 WP_001117767.1.81064 WP_001117767.1.81065 WP_001117767.1.81085 WP_001117767.1.81092 WP_001117767.1.81095 WP_001117767.1.81097 WP_001117767.1.81114 WP_001117767.1.81132 WP_001117767.1.81151 WP_001117767.1.81157 WP_001117767.1.81171 WP_001117767.1.81176 WP_001117767.1.81184 WP_001117767.1.81214 WP_001117767.1.81224 WP_001117767.1.81228 WP_001117767.1.81232 WP_001117767.1.81234 WP_001117767.1.81243 WP_001117767.1.8125 WP_001117767.1.81252 WP_001117767.1.81288 WP_001117767.1.81344 WP_001117767.1.8135 WP_001117767.1.81379 WP_001117767.1.81385 WP_001117767.1.81387 WP_001117767.1.81389 WP_001117767.1.8142 WP_001117767.1.81436 WP_001117767.1.8144 WP_001117767.1.81464 WP_001117767.1.81467 WP_001117767.1.81508 WP_001117767.1.81532 WP_001117767.1.81549 WP_001117767.1.81572 WP_001117767.1.81574 WP_001117767.1.81599 WP_001117767.1.8160 WP_001117767.1.81604 WP_001117767.1.81610 WP_001117767.1.81619 WP_001117767.1.81631 WP_001117767.1.81637 WP_001117767.1.81645 WP_001117767.1.81718 WP_001117767.1.81734 WP_001117767.1.81738 WP_001117767.1.81740 WP_001117767.1.81758 WP_001117767.1.8176 WP_001117767.1.81767 WP_001117767.1.81789 WP_001117767.1.8180 WP_001117767.1.81800 WP_001117767.1.81810 WP_001117767.1.81812 WP_001117767.1.81829 WP_001117767.1.81831 WP_001117767.1.81838 WP_001117767.1.8185 WP_001117767.1.81861 WP_001117767.1.81870 WP_001117767.1.8188 WP_001117767.1.81897 WP_001117767.1.81903 WP_001117767.1.81904 WP_001117767.1.81905 WP_001117767.1.81906 WP_001117767.1.81919 WP_001117767.1.81940 WP_001117767.1.81944 WP_001117767.1.81955 WP_001117767.1.81969 WP_001117767.1.81982 WP_001117767.1.81990 WP_001117767.1.81996 WP_001117767.1.81999 WP_001117767.1.82015 WP_001117767.1.82017 WP_001117767.1.82053 WP_001117767.1.8206 WP_001117767.1.82091 WP_001117767.1.82103 WP_001117767.1.8212 WP_001117767.1.82121 WP_001117767.1.82161 WP_001117767.1.82167 WP_001117767.1.82174 WP_001117767.1.82184 WP_001117767.1.82219 WP_001117767.1.82234 WP_001117767.1.82247 WP_001117767.1.82253 WP_001117767.1.82259 WP_001117767.1.82281 WP_001117767.1.82301 WP_001117767.1.82315 WP_001117767.1.82340 WP_001117767.1.82349 WP_001117767.1.82354 WP_001117767.1.82358 WP_001117767.1.82368 WP_001117767.1.82406 WP_001117767.1.8244 WP_001117767.1.82441 WP_001117767.1.82447 WP_001117767.1.82455 WP_001117767.1.82458 WP_001117767.1.8246 WP_001117767.1.82467 WP_001117767.1.82468 WP_001117767.1.82525 WP_001117767.1.82548 WP_001117767.1.82558 WP_001117767.1.8261 WP_001117767.1.82612 WP_001117767.1.8265 WP_001117767.1.8266 WP_001117767.1.82664 WP_001117767.1.82678 WP_001117767.1.82709 WP_001117767.1.82724 WP_001117767.1.82760 WP_001117767.1.82762 WP_001117767.1.82768 WP_001117767.1.82775 WP_001117767.1.82796 WP_001117767.1.8280 WP_001117767.1.82802 WP_001117767.1.82824 WP_001117767.1.82829 WP_001117767.1.82835 WP_001117767.1.82855 WP_001117767.1.82862 WP_001117767.1.8288 WP_001117767.1.8289 WP_001117767.1.82916 WP_001117767.1.82930 WP_001117767.1.82931 WP_001117767.1.82941 WP_001117767.1.82976 WP_001117767.1.82980 WP_001117767.1.82984 WP_001117767.1.82997 WP_001117767.1.83011 WP_001117767.1.83013 WP_001117767.1.8302 WP_001117767.1.83021 WP_001117767.1.83046 WP_001117767.1.83050 WP_001117767.1.83053 WP_001117767.1.83054 WP_001117767.1.83066 WP_001117767.1.83078 WP_001117767.1.83088 WP_001117767.1.8310 WP_001117767.1.83103 WP_001117767.1.83152 WP_001117767.1.83153 WP_001117767.1.8318 WP_001117767.1.83185 WP_001117767.1.8319 WP_001117767.1.83193 WP_001117767.1.83203 WP_001117767.1.83234 WP_001117767.1.83243 WP_001117767.1.83249 WP_001117767.1.83250 WP_001117767.1.8328 WP_001117767.1.83291 WP_001117767.1.83316 WP_001117767.1.83352 WP_001117767.1.83359 WP_001117767.1.83372 WP_001117767.1.83405 WP_001117767.1.83416 WP_001117767.1.83417 WP_001117767.1.83418 WP_001117767.1.8346 WP_001117767.1.83467 WP_001117767.1.83468 WP_001117767.1.83472 WP_001117767.1.83475 WP_001117767.1.83476 WP_001117767.1.83479 WP_001117767.1.83484 WP_001117767.1.83508 WP_001117767.1.83517 WP_001117767.1.83520 WP_001117767.1.83553 WP_001117767.1.83592 WP_001117767.1.83593 WP_001117767.1.83597 WP_001117767.1.83624 WP_001117767.1.83626 WP_001117767.1.83645 WP_001117767.1.83646 WP_001117767.1.83652 WP_001117767.1.83653 WP_001117767.1.8366 WP_001117767.1.83674 WP_001117767.1.83676 WP_001117767.1.83714 WP_001117767.1.83720 WP_001117767.1.83728 WP_001117767.1.83750 WP_001117767.1.83756 WP_001117767.1.83758 WP_001117767.1.83763 WP_001117767.1.83769 WP_001117767.1.83770 WP_001117767.1.83775 WP_001117767.1.83778 WP_001117767.1.83788 WP_001117767.1.83792 WP_001117767.1.83797 WP_001117767.1.83816 WP_001117767.1.83825 WP_001117767.1.8383 WP_001117767.1.83837 WP_001117767.1.83844 WP_001117767.1.83852 WP_001117767.1.83864 WP_001117767.1.83865 WP_001117767.1.83868 WP_001117767.1.83881 WP_001117767.1.83886 WP_001117767.1.83902 WP_001117767.1.83905 WP_001117767.1.83912 WP_001117767.1.83917 WP_001117767.1.83919 WP_001117767.1.83925 WP_001117767.1.83928 WP_001117767.1.83935 WP_001117767.1.83955 WP_001117767.1.83984 WP_001117767.1.83989 WP_001117767.1.84010 WP_001117767.1.84025 WP_001117767.1.84041 WP_001117767.1.84049 WP_001117767.1.84054 WP_001117767.1.84064 WP_001117767.1.84067 WP_001117767.1.84068 WP_001117767.1.84118 WP_001117767.1.84129 WP_001117767.1.84144 WP_001117767.1.84161 WP_001117767.1.84163 WP_001117767.1.84188 WP_001117767.1.84194 WP_001117767.1.84275 WP_001117767.1.84284 WP_001117767.1.84293 WP_001117767.1.8432 WP_001117767.1.84322 WP_001117767.1.84342 WP_001117767.1.84414 WP_001117767.1.84415 WP_001117767.1.84416 WP_001117767.1.84418 WP_001117767.1.84442 WP_001117767.1.84445 WP_001117767.1.84451 WP_001117767.1.84508 WP_001117767.1.84509 WP_001117767.1.84555 WP_001117767.1.84563 WP_001117767.1.84570 WP_001117767.1.84578 WP_001117767.1.84590 WP_001117767.1.84596 WP_001117767.1.84602 WP_001117767.1.84608 WP_001117767.1.84612 WP_001117767.1.8462 WP_001117767.1.84625 WP_001117767.1.84630 WP_001117767.1.84638 WP_001117767.1.84648 WP_001117767.1.84652 WP_001117767.1.84662 WP_001117767.1.84673 WP_001117767.1.84679 WP_001117767.1.8468 WP_001117767.1.84682 WP_001117767.1.84696 WP_001117767.1.84714 WP_001117767.1.84736 WP_001117767.1.8475 WP_001117767.1.84752 WP_001117767.1.84757 WP_001117767.1.84761 WP_001117767.1.84815 WP_001117767.1.84826 WP_001117767.1.84844 WP_001117767.1.84847 WP_001117767.1.84854 WP_001117767.1.84874 WP_001117767.1.84889 WP_001117767.1.84903 WP_001117767.1.84907 WP_001117767.1.84922 WP_001117767.1.8493 WP_001117767.1.84943 WP_001117767.1.84951 WP_001117767.1.8496 WP_001117767.1.84975 WP_001117767.1.84978 WP_001117767.1.85017 WP_001117767.1.85022 WP_001117767.1.85026 WP_001117767.1.85045 WP_001117767.1.85047 WP_001117767.1.85056 WP_001117767.1.85070 WP_001117767.1.85081 WP_001117767.1.85083 WP_001117767.1.85099 WP_001117767.1.851 WP_001117767.1.85113 WP_001117767.1.85132 WP_001117767.1.85133 WP_001117767.1.85135 WP_001117767.1.85144 WP_001117767.1.85151 WP_001117767.1.85160 WP_001117767.1.85198 WP_001117767.1.85213 WP_001117767.1.85224 WP_001117767.1.85226 WP_001117767.1.85229 WP_001117767.1.85231 WP_001117767.1.85235 WP_001117767.1.85238 WP_001117767.1.85265 WP_001117767.1.85289 WP_001117767.1.85292 WP_001117767.1.85294 WP_001117767.1.85297 WP_001117767.1.85302 WP_001117767.1.85331 WP_001117767.1.85351 WP_001117767.1.85354 WP_001117767.1.85374 WP_001117767.1.85375 WP_001117767.1.85376 WP_001117767.1.85383 WP_001117767.1.85391 WP_001117767.1.85395 WP_001117767.1.85401 WP_001117767.1.85404 WP_001117767.1.85409 WP_001117767.1.85425 WP_001117767.1.85440 WP_001117767.1.85441 WP_001117767.1.85445 WP_001117767.1.85455 WP_001117767.1.85462 WP_001117767.1.85471 WP_001117767.1.85474 WP_001117767.1.85485 WP_001117767.1.85492 WP_001117767.1.85506 WP_001117767.1.8551 WP_001117767.1.85515 WP_001117767.1.85519 WP_001117767.1.85542 WP_001117767.1.85547 WP_001117767.1.85549 WP_001117767.1.85555 WP_001117767.1.85562 WP_001117767.1.85586 WP_001117767.1.85596 WP_001117767.1.85607 WP_001117767.1.85611 WP_001117767.1.85634 WP_001117767.1.85649 WP_001117767.1.85678 WP_001117767.1.85705 WP_001117767.1.8572 WP_001117767.1.85730 WP_001117767.1.85732 WP_001117767.1.85758 WP_001117767.1.8576 WP_001117767.1.85795 WP_001117767.1.85796 WP_001117767.1.85809 WP_001117767.1.85816 WP_001117767.1.85834 WP_001117767.1.85844 WP_001117767.1.85858 WP_001117767.1.85873 WP_001117767.1.85906 WP_001117767.1.85924 WP_001117767.1.85927 WP_001117767.1.85950 WP_001117767.1.85971 WP_001117767.1.85980 WP_001117767.1.85989 WP_001117767.1.85993 WP_001117767.1.86018 WP_001117767.1.86036 WP_001117767.1.86042 WP_001117767.1.86072 WP_001117767.1.86086 WP_001117767.1.8609 WP_001117767.1.86101 WP_001117767.1.86106 WP_001117767.1.86123 WP_001117767.1.86136 WP_001117767.1.86144 WP_001117767.1.86153 WP_001117767.1.86154 WP_001117767.1.86158 WP_001117767.1.8617 WP_001117767.1.86178 WP_001117767.1.86188 WP_001117767.1.86197 WP_001117767.1.86207 WP_001117767.1.86209 WP_001117767.1.86248 WP_001117767.1.86256 WP_001117767.1.8627 WP_001117767.1.86270 WP_001117767.1.86304 WP_001117767.1.86315 WP_001117767.1.86331 WP_001117767.1.86344 WP_001117767.1.86363 WP_001117767.1.86367 WP_001117767.1.86378 WP_001117767.1.8641 WP_001117767.1.8643 WP_001117767.1.86439 WP_001117767.1.86455 WP_001117767.1.86482 WP_001117767.1.86505 WP_001117767.1.86508 WP_001117767.1.86523 WP_001117767.1.86526 WP_001117767.1.86531 WP_001117767.1.86542 WP_001117767.1.86606 WP_001117767.1.86628 WP_001117767.1.86629 WP_001117767.1.8663 WP_001117767.1.86664 WP_001117767.1.86704 WP_001117767.1.86706 WP_001117767.1.86736 WP_001117767.1.86745 WP_001117767.1.86754 WP_001117767.1.86792 WP_001117767.1.86793 WP_001117767.1.86795 WP_001117767.1.8681 WP_001117767.1.86838 WP_001117767.1.86881 WP_001117767.1.8690 WP_001117767.1.86910 WP_001117767.1.86911 WP_001117767.1.86916 WP_001117767.1.86940 WP_001117767.1.86942 WP_001117767.1.86955 WP_001117767.1.86961 WP_001117767.1.86968 WP_001117767.1.86977 WP_001117767.1.86999 WP_001117767.1.87021 WP_001117767.1.87022 WP_001117767.1.87042 WP_001117767.1.87057 WP_001117767.1.87072 WP_001117767.1.87088 WP_001117767.1.87090 WP_001117767.1.87097 WP_001117767.1.87100 WP_001117767.1.87119 WP_001117767.1.8712 WP_001117767.1.87122 WP_001117767.1.87137 WP_001117767.1.87141 WP_001117767.1.87168 WP_001117767.1.87175 WP_001117767.1.87190 WP_001117767.1.87194 WP_001117767.1.8720 WP_001117767.1.87221 WP_001117767.1.87236 WP_001117767.1.87250 WP_001117767.1.87260 WP_001117767.1.87261 WP_001117767.1.87263 WP_001117767.1.87264 WP_001117767.1.87272 WP_001117767.1.87285 WP_001117767.1.87290 WP_001117767.1.87296 WP_001117767.1.87363 WP_001117767.1.87372 WP_001117767.1.87378 WP_001117767.1.87388 WP_001117767.1.87391 WP_001117767.1.87396 WP_001117767.1.87397 WP_001117767.1.87425 WP_001117767.1.87434 WP_001117767.1.87457 WP_001117767.1.87461 WP_001117767.1.87466 WP_001117767.1.87475 WP_001117767.1.87486 WP_001117767.1.87498 WP_001117767.1.875 WP_001117767.1.87502 WP_001117767.1.87508 WP_001117767.1.87511 WP_001117767.1.87515 WP_001117767.1.8753 WP_001117767.1.87534 WP_001117767.1.87541 WP_001117767.1.87543 WP_001117767.1.87593 WP_001117767.1.87595 WP_001117767.1.87601 WP_001117767.1.87623 WP_001117767.1.87636 WP_001117767.1.8764 WP_001117767.1.87682 WP_001117767.1.8770 WP_001117767.1.87703 WP_001117767.1.87710 WP_001117767.1.87718 WP_001117767.1.87740 WP_001117767.1.87745 WP_001117767.1.87748 WP_001117767.1.87764 WP_001117767.1.87782 WP_001117767.1.8779 WP_001117767.1.87802 WP_001117767.1.87808 WP_001117767.1.87828 WP_001117767.1.87838 WP_001117767.1.87841 WP_001117767.1.87854 WP_001117767.1.87865 WP_001117767.1.87879 WP_001117767.1.8791 WP_001117767.1.87912 WP_001117767.1.87937 WP_001117767.1.87943 WP_001117767.1.87948 WP_001117767.1.87963 WP_001117767.1.87964 WP_001117767.1.87967 WP_001117767.1.87972 WP_001117767.1.87995 WP_001117767.1.88013 WP_001117767.1.88032 WP_001117767.1.88061 WP_001117767.1.88114 WP_001117767.1.88150 WP_001117767.1.88166 WP_001117767.1.88169 WP_001117767.1.8820 WP_001117767.1.88212 WP_001117767.1.88240 WP_001117767.1.88270 WP_001117767.1.88279 WP_001117767.1.88309 WP_001117767.1.88311 WP_001117767.1.88317 WP_001117767.1.88319 WP_001117767.1.88328 WP_001117767.1.88339 WP_001117767.1.88348 WP_001117767.1.88351 WP_001117767.1.88367 WP_001117767.1.88371 WP_001117767.1.88373 WP_001117767.1.88375 WP_001117767.1.88380 WP_001117767.1.88418 WP_001117767.1.88430 WP_001117767.1.88440 WP_001117767.1.88445 WP_001117767.1.88449 WP_001117767.1.8847 WP_001117767.1.88471 WP_001117767.1.88473 WP_001117767.1.88480 WP_001117767.1.88498 WP_001117767.1.88504 WP_001117767.1.88518 WP_001117767.1.88536 WP_001117767.1.88555 WP_001117767.1.88558 WP_001117767.1.88560 WP_001117767.1.88563 WP_001117767.1.8857 WP_001117767.1.88572 WP_001117767.1.88580 WP_001117767.1.88583 WP_001117767.1.88585 WP_001117767.1.8859 WP_001117767.1.88599 WP_001117767.1.88600 WP_001117767.1.88614 WP_001117767.1.88623 WP_001117767.1.88636 WP_001117767.1.88638 WP_001117767.1.88642 WP_001117767.1.88671 WP_001117767.1.88694 WP_001117767.1.88696 WP_001117767.1.8872 WP_001117767.1.88739 WP_001117767.1.88753 WP_001117767.1.88761 WP_001117767.1.8877 WP_001117767.1.88771 WP_001117767.1.88781 WP_001117767.1.88827 WP_001117767.1.88843 WP_001117767.1.88856 WP_001117767.1.88859 WP_001117767.1.8886 WP_001117767.1.88861 WP_001117767.1.88871 WP_001117767.1.88874 WP_001117767.1.88878 WP_001117767.1.8888 WP_001117767.1.88881 WP_001117767.1.88897 WP_001117767.1.88912 WP_001117767.1.88922 WP_001117767.1.88934 WP_001117767.1.88954 WP_001117767.1.88962 WP_001117767.1.88987 WP_001117767.1.8899 WP_001117767.1.8900 WP_001117767.1.89012 WP_001117767.1.89024 WP_001117767.1.89027 WP_001117767.1.89036 WP_001117767.1.89070 WP_001117767.1.89086 WP_001117767.1.89103 WP_001117767.1.89108 WP_001117767.1.8913 WP_001117767.1.89133 WP_001117767.1.89139 WP_001117767.1.89164 WP_001117767.1.89173 WP_001117767.1.8918 WP_001117767.1.89181 WP_001117767.1.89184 WP_001117767.1.89194 WP_001117767.1.89195 WP_001117767.1.89204 WP_001117767.1.89216 WP_001117767.1.89229 WP_001117767.1.89235 WP_001117767.1.89237 WP_001117767.1.8924 WP_001117767.1.89258 WP_001117767.1.89284 WP_001117767.1.8929 WP_001117767.1.89290 WP_001117767.1.89347 WP_001117767.1.89348 WP_001117767.1.89350 WP_001117767.1.89372 WP_001117767.1.89390 WP_001117767.1.89404 WP_001117767.1.89414 WP_001117767.1.89433 WP_001117767.1.89476 WP_001117767.1.8950 WP_001117767.1.89516 WP_001117767.1.8953 WP_001117767.1.89537 WP_001117767.1.89544 WP_001117767.1.89545 WP_001117767.1.89556 WP_001117767.1.89557 WP_001117767.1.89559 WP_001117767.1.89594 WP_001117767.1.89603 WP_001117767.1.89628 WP_001117767.1.89651 WP_001117767.1.89655 WP_001117767.1.89672 WP_001117767.1.89678 WP_001117767.1.89686 WP_001117767.1.89715 WP_001117767.1.89726 WP_001117767.1.89730 WP_001117767.1.89738 WP_001117767.1.89754 WP_001117767.1.89779 WP_001117767.1.89794 WP_001117767.1.89799 WP_001117767.1.898 WP_001117767.1.89857 WP_001117767.1.8986 WP_001117767.1.89860 WP_001117767.1.89863 WP_001117767.1.89883 WP_001117767.1.89908 WP_001117767.1.89924 WP_001117767.1.89933 WP_001117767.1.89935 WP_001117767.1.89949 WP_001117767.1.89950 WP_001117767.1.89960 WP_001117767.1.90005 WP_001117767.1.90018 WP_001117767.1.90038 WP_001117767.1.90046 WP_001117767.1.90055 WP_001117767.1.90069 WP_001117767.1.90091 WP_001117767.1.90095 WP_001117767.1.90112 WP_001117767.1.90131 WP_001117767.1.90145 WP_001117767.1.90148 WP_001117767.1.90161 WP_001117767.1.90173 WP_001117767.1.90174 WP_001117767.1.90180 WP_001117767.1.90215 WP_001117767.1.90217 WP_001117767.1.9022 WP_001117767.1.90232 WP_001117767.1.90243 WP_001117767.1.90244 WP_001117767.1.90246 WP_001117767.1.90250 WP_001117767.1.90253 WP_001117767.1.90276 WP_001117767.1.9030 WP_001117767.1.90307 WP_001117767.1.90331 WP_001117767.1.90345 WP_001117767.1.90367 WP_001117767.1.90370 WP_001117767.1.90386 WP_001117767.1.90432 WP_001117767.1.90447 WP_001117767.1.90454 WP_001117767.1.90473 WP_001117767.1.90475 WP_001117767.1.90488 WP_001117767.1.90506 WP_001117767.1.90517 WP_001117767.1.90533 WP_001117767.1.90544 WP_001117767.1.90548 WP_001117767.1.9055 WP_001117767.1.90554 WP_001117767.1.90556 WP_001117767.1.90562 WP_001117767.1.90604 WP_001117767.1.90647 WP_001117767.1.90660 WP_001117767.1.90683 WP_001117767.1.90698 WP_001117767.1.9071 WP_001117767.1.90726 WP_001117767.1.90728 WP_001117767.1.90738 WP_001117767.1.9074 WP_001117767.1.90740 WP_001117767.1.90745 WP_001117767.1.90757 WP_001117767.1.9076 WP_001117767.1.90777 WP_001117767.1.90801 WP_001117767.1.90804 WP_001117767.1.90818 WP_001117767.1.90820 WP_001117767.1.90861 WP_001117767.1.90875 WP_001117767.1.90887 WP_001117767.1.90896 WP_001117767.1.90903 WP_001117767.1.90923 WP_001117767.1.90928 WP_001117767.1.9100 WP_001117767.1.91005 WP_001117767.1.91011 WP_001117767.1.91019 WP_001117767.1.91054 WP_001117767.1.91087 WP_001117767.1.91089 WP_001117767.1.91124 WP_001117767.1.91126 WP_001117767.1.9114 WP_001117767.1.91150 WP_001117767.1.91158 WP_001117767.1.91177 WP_001117767.1.912 WP_001117767.1.9122 WP_001117767.1.91233 WP_001117767.1.91246 WP_001117767.1.91252 WP_001117767.1.91258 WP_001117767.1.9127 WP_001117767.1.91279 WP_001117767.1.91280 WP_001117767.1.91297 WP_001117767.1.9130 WP_001117767.1.91300 WP_001117767.1.91310 WP_001117767.1.91316 WP_001117767.1.91346 WP_001117767.1.91357 WP_001117767.1.91364 WP_001117767.1.91365 WP_001117767.1.91371 WP_001117767.1.91380 WP_001117767.1.91382 WP_001117767.1.9140 WP_001117767.1.91420 WP_001117767.1.91427 WP_001117767.1.91447 WP_001117767.1.91465 WP_001117767.1.91486 WP_001117767.1.91487 WP_001117767.1.91500 WP_001117767.1.91501 WP_001117767.1.91525 WP_001117767.1.9153 WP_001117767.1.91530 WP_001117767.1.91542 WP_001117767.1.91547 WP_001117767.1.9155 WP_001117767.1.91559 WP_001117767.1.91573 WP_001117767.1.91581 WP_001117767.1.91586 WP_001117767.1.91587 WP_001117767.1.91591 WP_001117767.1.91611 WP_001117767.1.91624 WP_001117767.1.91634 WP_001117767.1.91635 WP_001117767.1.91639 WP_001117767.1.91660 WP_001117767.1.91670 WP_001117767.1.917 WP_001117767.1.91704 WP_001117767.1.91745 WP_001117767.1.91746 WP_001117767.1.91749 WP_001117767.1.91771 WP_001117767.1.91781 WP_001117767.1.91791 WP_001117767.1.91800 WP_001117767.1.91816 WP_001117767.1.91829 WP_001117767.1.91848 WP_001117767.1.91895 WP_001117767.1.91909 WP_001117767.1.91911 WP_001117767.1.91918 WP_001117767.1.91919 WP_001117767.1.91928 WP_001117767.1.91950 WP_001117767.1.91955 WP_001117767.1.92 WP_001117767.1.92055 WP_001117767.1.92057 WP_001117767.1.92080 WP_001117767.1.92104 WP_001117767.1.92110 WP_001117767.1.92115 WP_001117767.1.92125 WP_001117767.1.92133 WP_001117767.1.92140 WP_001117767.1.92143 WP_001117767.1.92147 WP_001117767.1.92158 WP_001117767.1.92164 WP_001117767.1.92169 WP_001117767.1.92173 WP_001117767.1.92185 WP_001117767.1.92186 WP_001117767.1.92196 WP_001117767.1.92212 WP_001117767.1.92218 WP_001117767.1.92227 WP_001117767.1.92228 WP_001117767.1.9224 WP_001117767.1.92244 WP_001117767.1.92249 WP_001117767.1.92253 WP_001117767.1.92254 WP_001117767.1.92278 WP_001117767.1.923 WP_001117767.1.92303 WP_001117767.1.92324 WP_001117767.1.9234 WP_001117767.1.92340 WP_001117767.1.9237 WP_001117767.1.9239 WP_001117767.1.92391 WP_001117767.1.92398 WP_001117767.1.92405 WP_001117767.1.92415 WP_001117767.1.92424 WP_001117767.1.92425 WP_001117767.1.92442 WP_001117767.1.9247 WP_001117767.1.92479 WP_001117767.1.92488 WP_001117767.1.92497 WP_001117767.1.92500 WP_001117767.1.92512 WP_001117767.1.92520 WP_001117767.1.92534 WP_001117767.1.92541 WP_001117767.1.92544 WP_001117767.1.92546 WP_001117767.1.92560 WP_001117767.1.92565 WP_001117767.1.92602 WP_001117767.1.92607 WP_001117767.1.92667 WP_001117767.1.92674 WP_001117767.1.92679 WP_001117767.1.92688 WP_001117767.1.92691 WP_001117767.1.92718 WP_001117767.1.92723 WP_001117767.1.92726 WP_001117767.1.92735 WP_001117767.1.92741 WP_001117767.1.92765 WP_001117767.1.92772 WP_001117767.1.92773 WP_001117767.1.92778 WP_001117767.1.92789 WP_001117767.1.92795 WP_001117767.1.92805 WP_001117767.1.92840 WP_001117767.1.92848 WP_001117767.1.9286 WP_001117767.1.92862 WP_001117767.1.92864 WP_001117767.1.92918 WP_001117767.1.9293 WP_001117767.1.92937 WP_001117767.1.9296 WP_001117767.1.92960 WP_001117767.1.92965 WP_001117767.1.9298 WP_001117767.1.92997 WP_001117767.1.93010 WP_001117767.1.93041 WP_001117767.1.93047 WP_001117767.1.93068 WP_001117767.1.93071 WP_001117767.1.93074 WP_001117767.1.93078 WP_001117767.1.93125 WP_001117767.1.93141 WP_001117767.1.93147 WP_001117767.1.93163 WP_001117767.1.93176 WP_001117767.1.93191 WP_001117767.1.93197 WP_001117767.1.93198 WP_001117767.1.93207 WP_001117767.1.93211 WP_001117767.1.93224 WP_001117767.1.93231 WP_001117767.1.93235 WP_001117767.1.93237 WP_001117767.1.93243 WP_001117767.1.93251 WP_001117767.1.93254 WP_001117767.1.93260 WP_001117767.1.93263 WP_001117767.1.93272 WP_001117767.1.93296 WP_001117767.1.9330 WP_001117767.1.93300 WP_001117767.1.93329 WP_001117767.1.93336 WP_001117767.1.93354 WP_001117767.1.93374 WP_001117767.1.93378 WP_001117767.1.93416 WP_001117767.1.93438 WP_001117767.1.93444 WP_001117767.1.9346 WP_001117767.1.93471 WP_001117767.1.93514 WP_001117767.1.9352 WP_001117767.1.93538 WP_001117767.1.9354 WP_001117767.1.93561 WP_001117767.1.93579 WP_001117767.1.9358 WP_001117767.1.93590 WP_001117767.1.93613 WP_001117767.1.93647 WP_001117767.1.93658 WP_001117767.1.93669 WP_001117767.1.93678 WP_001117767.1.93708 WP_001117767.1.93710 WP_001117767.1.93722 WP_001117767.1.93736 WP_001117767.1.93738 WP_001117767.1.93758 WP_001117767.1.93762 WP_001117767.1.93769 WP_001117767.1.93775 WP_001117767.1.93787 WP_001117767.1.93862 WP_001117767.1.9387 WP_001117767.1.93882 WP_001117767.1.93883 WP_001117767.1.93890 WP_001117767.1.93891 WP_001117767.1.93934 WP_001117767.1.93972 WP_001117767.1.93975 WP_001117767.1.93976 WP_001117767.1.9398 WP_001117767.1.93981 WP_001117767.1.94 WP_001117767.1.94009 WP_001117767.1.94016 WP_001117767.1.94053 WP_001117767.1.94060 WP_001117767.1.94074 WP_001117767.1.9408 WP_001117767.1.94080 WP_001117767.1.94082 WP_001117767.1.94087 WP_001117767.1.94093 WP_001117767.1.94096 WP_001117767.1.9411 WP_001117767.1.94114 WP_001117767.1.94119 WP_001117767.1.94122 WP_001117767.1.94123 WP_001117767.1.94130 WP_001117767.1.94165 WP_001117767.1.94172 WP_001117767.1.94182 WP_001117767.1.94209 WP_001117767.1.94229 WP_001117767.1.94242 WP_001117767.1.94245 WP_001117767.1.94248 WP_001117767.1.94268 WP_001117767.1.94287 WP_001117767.1.94293 WP_001117767.1.94294 WP_001117767.1.9430 WP_001117767.1.94320 WP_001117767.1.94335 WP_001117767.1.94337 WP_001117767.1.94340 WP_001117767.1.94341 WP_001117767.1.94345 WP_001117767.1.9437 WP_001117767.1.94374 WP_001117767.1.94375 WP_001117767.1.94376 WP_001117767.1.94407 WP_001117767.1.94409 WP_001117767.1.94414 WP_001117767.1.94423 WP_001117767.1.94484 WP_001117767.1.94530 WP_001117767.1.94536 WP_001117767.1.94549 WP_001117767.1.9455 WP_001117767.1.94550 WP_001117767.1.94576 WP_001117767.1.94625 WP_001117767.1.94636 WP_001117767.1.9464 WP_001117767.1.94641 WP_001117767.1.94684 WP_001117767.1.94688 WP_001117767.1.947 WP_001117767.1.94719 WP_001117767.1.94733 WP_001117767.1.94741 WP_001117767.1.94789 WP_001117767.1.94797 WP_001117767.1.94825 WP_001117767.1.94838 WP_001117767.1.94844 WP_001117767.1.94845 WP_001117767.1.9485 WP_001117767.1.94857 WP_001117767.1.94866 WP_001117767.1.94941 WP_001117767.1.9495 WP_001117767.1.94958 WP_001117767.1.94969 WP_001117767.1.9497 WP_001117767.1.94980 WP_001117767.1.94989 WP_001117767.1.94999 WP_001117767.1.95002 WP_001117767.1.95014 WP_001117767.1.95023 WP_001117767.1.95029 WP_001117767.1.95033 WP_001117767.1.95038 WP_001117767.1.95049 WP_001117767.1.95075 WP_001117767.1.95077 WP_001117767.1.95090 WP_001117767.1.9510 WP_001117767.1.95120 WP_001117767.1.95156 WP_001117767.1.95174 WP_001117767.1.95193 WP_001117767.1.95210 WP_001117767.1.95263 WP_001117767.1.95294 WP_001117767.1.95304 WP_001117767.1.95318 WP_001117767.1.95327 WP_001117767.1.95342 WP_001117767.1.95361 WP_001117767.1.95372 WP_001117767.1.9538 WP_001117767.1.95386 WP_001117767.1.95409 WP_001117767.1.95415 WP_001117767.1.9544 WP_001117767.1.95442 WP_001117767.1.95452 WP_001117767.1.95494 WP_001117767.1.95500 WP_001117767.1.95512 WP_001117767.1.95519 WP_001117767.1.95522 WP_001117767.1.95535 WP_001117767.1.95537 WP_001117767.1.95545 WP_001117767.1.95550 WP_001117767.1.95552 WP_001117767.1.95560 WP_001117767.1.9557 WP_001117767.1.95571 WP_001117767.1.95581 WP_001117767.1.95603 WP_001117767.1.95631 WP_001117767.1.95639 WP_001117767.1.95640 WP_001117767.1.95681 WP_001117767.1.95683 WP_001117767.1.95699 WP_001117767.1.95704 WP_001117767.1.95713 WP_001117767.1.95714 WP_001117767.1.95737 WP_001117767.1.95760 WP_001117767.1.95780 WP_001117767.1.95781 WP_001117767.1.95804 WP_001117767.1.95806 WP_001117767.1.95877 WP_001117767.1.95885 WP_001117767.1.959 WP_001117767.1.95914 WP_001117767.1.95918 WP_001117767.1.95947 WP_001117767.1.95954 WP_001117767.1.95962 WP_001117767.1.95983 WP_001117767.1.95986 WP_001117767.1.95997 WP_001117767.1.96014 WP_001117767.1.96030 WP_001117767.1.96056 WP_001117767.1.96057 WP_001117767.1.96067 WP_001117767.1.96075 WP_001117767.1.96105 WP_001117767.1.96133 WP_001117767.1.96135 WP_001117767.1.96148 WP_001117767.1.96160 WP_001117767.1.96163 WP_001117767.1.96165 WP_001117767.1.9617 WP_001117767.1.96209 WP_001117767.1.96218 WP_001117767.1.96221 WP_001117767.1.96228 WP_001117767.1.96255 WP_001117767.1.96271 WP_001117767.1.96280 WP_001117767.1.96283 WP_001117767.1.96297 WP_001117767.1.96301 WP_001117767.1.96305 WP_001117767.1.96312 WP_001117767.1.96314 WP_001117767.1.96316 WP_001117767.1.96322 WP_001117767.1.96334 WP_001117767.1.96362 WP_001117767.1.96364 WP_001117767.1.96424 WP_001117767.1.96433 WP_001117767.1.96468 WP_001117767.1.96472 WP_001117767.1.96474 WP_001117767.1.96477 WP_001117767.1.96489 WP_001117767.1.96495 WP_001117767.1.9650 WP_001117767.1.96509 WP_001117767.1.96535 WP_001117767.1.96538 WP_001117767.1.96548 WP_001117767.1.96550 WP_001117767.1.96554 WP_001117767.1.96566 WP_001117767.1.96568 WP_001117767.1.96578 WP_001117767.1.96591 WP_001117767.1.96603 WP_001117767.1.96628 WP_001117767.1.96634 WP_001117767.1.96637 WP_001117767.1.96638 WP_001117767.1.96646 WP_001117767.1.96663 WP_001117767.1.96678 WP_001117767.1.96682 WP_001117767.1.96699 WP_001117767.1.96705 WP_001117767.1.96718 WP_001117767.1.96727 WP_001117767.1.9675 WP_001117767.1.96770 WP_001117767.1.96780 WP_001117767.1.96804 WP_001117767.1.96836 WP_001117767.1.9684 WP_001117767.1.96854 WP_001117767.1.96855 WP_001117767.1.96856 WP_001117767.1.96859 WP_001117767.1.96866 WP_001117767.1.96882 WP_001117767.1.96892 WP_001117767.1.96895 WP_001117767.1.96918 WP_001117767.1.96922 WP_001117767.1.96928 WP_001117767.1.96956 WP_001117767.1.96965 WP_001117767.1.96969 WP_001117767.1.96970 WP_001117767.1.96976 WP_001117767.1.96985 WP_001117767.1.96997 WP_001117767.1.97000 WP_001117767.1.97001 WP_001117767.1.97004 WP_001117767.1.97007 WP_001117767.1.97014 WP_001117767.1.97019 WP_001117767.1.97029 WP_001117767.1.97033 WP_001117767.1.97034 WP_001117767.1.97072 WP_001117767.1.97077 WP_001117767.1.97117 WP_001117767.1.97138 WP_001117767.1.97139 WP_001117767.1.97141 WP_001117767.1.97146 WP_001117767.1.97151 WP_001117767.1.97161 WP_001117767.1.97164 WP_001117767.1.97191 WP_001117767.1.97205 WP_001117767.1.97206 WP_001117767.1.97228 WP_001117767.1.97230 WP_001117767.1.97241 WP_001117767.1.97256 WP_001117767.1.97267 WP_001117767.1.97276 WP_001117767.1.97293 WP_001117767.1.97302 WP_001117767.1.97311 WP_001117767.1.97312 WP_001117767.1.97336 WP_001117767.1.97348 WP_001117767.1.97352 WP_001117767.1.97355 WP_001117767.1.97367 WP_001117767.1.9737 WP_001117767.1.97392 WP_001117767.1.97399 WP_001117767.1.97409 WP_001117767.1.97411 WP_001117767.1.97427 WP_001117767.1.9743 WP_001117767.1.97450 WP_001117767.1.97456 WP_001117767.1.97460 WP_001117767.1.97466 WP_001117767.1.97468 WP_001117767.1.9748 WP_001117767.1.97484 WP_001117767.1.97494 WP_001117767.1.97530 WP_001117767.1.97531 WP_001117767.1.97536 WP_001117767.1.97537 WP_001117767.1.97574 WP_001117767.1.97575 WP_001117767.1.97576 WP_001117767.1.9758 WP_001117767.1.97585 WP_001117767.1.97590 WP_001117767.1.97627 WP_001117767.1.97641 WP_001117767.1.97664 WP_001117767.1.97687 WP_001117767.1.97688 WP_001117767.1.97696 WP_001117767.1.97699 WP_001117767.1.97706 WP_001117767.1.97717 WP_001117767.1.97720 WP_001117767.1.97729 WP_001117767.1.97731 WP_001117767.1.97739 WP_001117767.1.97742 WP_001117767.1.97744 WP_001117767.1.97746 WP_001117767.1.97758 WP_001117767.1.97762 WP_001117767.1.97763 WP_001117767.1.97776 WP_001117767.1.97827 WP_001117767.1.97835 WP_001117767.1.9788 WP_001117767.1.9789 WP_001117767.1.97898 WP_001117767.1.97899 WP_001117767.1.97935 WP_001117767.1.97953 WP_001117767.1.97955 WP_001117767.1.97967 WP_001117767.1.97974 WP_001117767.1.97997 WP_001117767.1.98008 WP_001117767.1.98011 WP_001117767.1.98033 WP_001117767.1.98051 WP_001117767.1.98054 WP_001117767.1.98058 WP_001117767.1.98073 WP_001117767.1.98077 WP_001117767.1.98131 WP_001117767.1.98161 WP_001117767.1.98174 WP_001117767.1.98179 WP_001117767.1.98191 WP_001117767.1.98195 WP_001117767.1.98233 WP_001117767.1.98242 WP_001117767.1.98248 WP_001117767.1.98249 WP_001117767.1.98281 WP_001117767.1.98295 WP_001117767.1.98307 WP_001117767.1.98328 WP_001117767.1.98352 WP_001117767.1.98353 WP_001117767.1.98359 WP_001117767.1.98360 WP_001117767.1.98361 WP_001117767.1.98366 WP_001117767.1.98372 WP_001117767.1.98379 WP_001117767.1.98387 WP_001117767.1.98394 WP_001117767.1.98409 WP_001117767.1.98411 WP_001117767.1.98415 WP_001117767.1.98425 WP_001117767.1.98456 WP_001117767.1.98497 WP_001117767.1.98501 WP_001117767.1.98506 WP_001117767.1.98533 WP_001117767.1.98548 WP_001117767.1.98552 WP_001117767.1.98559 WP_001117767.1.98585 WP_001117767.1.98586 WP_001117767.1.986 WP_001117767.1.98609 WP_001117767.1.98655 WP_001117767.1.98659 WP_001117767.1.98667 WP_001117767.1.98703 WP_001117767.1.98706 WP_001117767.1.98710 WP_001117767.1.9872 WP_001117767.1.98723 WP_001117767.1.98730 WP_001117767.1.98734 WP_001117767.1.98741 WP_001117767.1.98750 WP_001117767.1.98767 WP_001117767.1.98786 WP_001117767.1.98797 WP_001117767.1.98805 WP_001117767.1.98821 WP_001117767.1.98825 WP_001117767.1.98837 WP_001117767.1.98842 WP_001117767.1.98858 WP_001117767.1.98865 WP_001117767.1.98874 WP_001117767.1.98880 WP_001117767.1.98883 WP_001117767.1.98894 WP_001117767.1.98912 WP_001117767.1.98924 WP_001117767.1.98967 WP_001117767.1.98978 WP_001117767.1.98981 WP_001117767.1.98985 WP_001117767.1.99009 WP_001117767.1.99025 WP_001117767.1.99027 WP_001117767.1.9903 WP_001117767.1.99081 WP_001117767.1.99090 WP_001117767.1.991 WP_001117767.1.9910 WP_001117767.1.9912 WP_001117767.1.99136 WP_001117767.1.99155 WP_001117767.1.99171 WP_001117767.1.99174 WP_001117767.1.99195 WP_001117767.1.99207 WP_001117767.1.99217 WP_001117767.1.99228 WP_001117767.1.99237 WP_001117767.1.99249 WP_001117767.1.99262 WP_001117767.1.99280 WP_001117767.1.99283 WP_001117767.1.99308 WP_001117767.1.99311 WP_001117767.1.99331 WP_001117767.1.99359 WP_001117767.1.9936 WP_001117767.1.99394 WP_001117767.1.99405 WP_001117767.1.99414 WP_001117767.1.99418 WP_001117767.1.99430 WP_001117767.1.99492 WP_001117767.1.99494 WP_001117767.1.99509 WP_001117767.1.99519 WP_001117767.1.99523 WP_001117767.1.99525 WP_001117767.1.99536 WP_001117767.1.99538 WP_001117767.1.99564 WP_001117767.1.99569 WP_001117767.1.9960 WP_001117767.1.99631 WP_001117767.1.99638 WP_001117767.1.9965 WP_001117767.1.99683 WP_001117767.1.99688 WP_001117767.1.99700 WP_001117767.1.9974 WP_001117767.1.99768 WP_001117767.1.99777 WP_001117767.1.99802 WP_001117767.1.99830 WP_001117767.1.99849 WP_001117767.1.9985 WP_001117767.1.99850 WP_001117767.1.99859 WP_001117767.1.99860 WP_001117767.1.9987 WP_001117767.1.99884 WP_001117767.1.99888 WP_001117767.1.99901 WP_001117767.1.99926 WP_001117767.1.99934 WP_001117767.1.99950 WP_001117767.1.99954 WP_001117767.1.99955 WP_001117767.1.99956 WP_001117767.1.99963 WP_001117767.1.99979 WP_001117767.1.99984 WP_001117767.1.99985 WP_001117767.1.99999 YP_500184.1.76163 gi|161509799|ref|YP_001575458.1| gi|384547804|ref|YP_005737057.1| gi|269203199|ref|YP_003282468.1| 158878.SAV1571 158879.SA1400 196620.MW1523 273036.SAB1443c 359786.SaurJH9_1629 359787.SaurJH1_1663 418127.SAHV_1558 426430.NWMN_1474 451515.SAUSA300_1531 451516.USA300HOU_1572 681288.SAAV_1563 93061.SAOUHSC_01673 gi|479329581|ref|YP_007868640.1| gi|148268055|ref|YP_001246998.1| APC23195 gi|88195380|ref|YP_500184.1| gi|384864792|ref|YP_005750151.1| gi|385781856|ref|YP_005758027.1| gi|387602911|ref|YP_005734432.1| gi|15927151|ref|NP_374684.1| gi|150394123|ref|YP_001316798.1| gi|156979889|ref|YP_001442148.1| gi|87162046|ref|YP_494226.1| gi|404478922|ref|YP_006710352.1| gi|379021353|ref|YP_005298015.1| gi|21283252|ref|NP_646340.1| gi|82751174|ref|YP_416915.1| gi|545635050|ref|YP_008585620.1| gi|151221686|ref|YP_001332508.1| gi|545637909|ref|YP_008588085.1| gi|387150714|ref|YP_005742278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]