SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 419610.Mext_0858 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419610.Mext_0858
Domain Number 1 Region: 153-276
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.42e-33
Family NlpC/P60 0.0022
Further Details:      
 
Weak hits

Sequence:  419610.Mext_0858
Domain Number - Region: 62-114
Classification Level Classification E-value
Superfamily SH3-domain 0.0266
Family SH3-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 419610.Mext_0858
Sequence length 286
Comment (Methylobacterium extorquens PA1)
Sequence
MPDTRDPRLTPARPDLADIRLRGVVTAERYVAGEPARVAVPSAPLRRAPRLEAGLETEAV
MGDAVTVFEIRDGFAWGQIARDGYVGYLPETALGAIDPAPTHRVAALRTFVYPAPDLKRP
HLAHLSLGAAFAAEAQEGEYWRLAGGGYVFAGHAVPLGTAEPDFPATAERLVGTPYLWGG
RTSLGLDCSGLVQLCLETAGRACPRDADQQERGLGTALPPGLDGLRRGDLVFWKGHVGMM
LDADRLIHANGHHMAVAVEPLREAVERIAVKSFGAVTAIRRLDPIA
Download sequence
Identical sequences A9W107
gi|163850291|ref|YP_001638334.1| WP_012252579.1.40058 WP_012252579.1.62458 419610.Mext_0858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]