SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 419610.Mext_1011 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419610.Mext_1011
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.26e-27
Family Sfri0576-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 419610.Mext_1011
Sequence length 120
Comment (Methylobacterium extorquens PA1)
Sequence
MLTYEKKPDSAIAEIVVDGKISDEEMNTVMTAMKADLDKGGRIKLLEDIRSFEGMEPAAF
FKDPRFGISMMKGVSHVALVTDATWLKAVAETFGFVSPVQIKVFERARISEARTWLEAAA
Download sequence
Identical sequences A0A0Q4WER0 A9W1G0 B7L0F5
gi|163850444|ref|YP_001638487.1| 419610.Mext_1011 440085.Mchl_0759 gi|218528790|ref|YP_002419606.1| WP_012252703.1.40058 WP_012252703.1.62458 WP_012252703.1.65134 WP_012252703.1.77525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]