SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 420247.Msm_0954 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  420247.Msm_0954
Domain Number 1 Region: 85-172
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.00039
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000207
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 420247.Msm_0954
Sequence length 206
Comment (Methanobrevibacter smithii ATCC 35061)
Sequence
MPETDYLKIPQNRIGALIGNKGDVKKSIEKATETILDIDSEDGTVYITPQENMSDPLGVW
NANHIVKAVARGFNPEVALKLVDDDIYLEVIKLPLYIGKSKNALSRYKGRIIGQNGKTRE
IIMDMAEVQMAIYGKTVSLIGEMDNIMIAKEAIEMILKGSRHKSVYSFLERKKDELKLKE
FKDLVGIKDDEIEFKDGIEFDEEMMK
Download sequence
Identical sequences A0A1D2WV15 A5ULT1 B9AEU1
420247.Msm_0954 WP_004035718.1.44750 WP_004035718.1.59899 WP_004035718.1.83718 gi|148643014|ref|YP_001273527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]