SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 420662.Mpe_B0346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  420662.Mpe_B0346
Domain Number 1 Region: 133-278
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.74e-31
Family DsbC/DsbG C-terminal domain-like 0.0041
Further Details:      
 
Domain Number 2 Region: 58-109
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.000000000011
Family DsbC/DsbG N-terminal domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 420662.Mpe_B0346
Sequence length 281
Comment (Methylibium petroleiphilum PM1)
Sequence
MQYITSTCNNSRIETQTQRSPLQPPMKRTILTLAAAAATLFAGAALADAKTDSILLNLKV
KYPATTFTGVRATPLQGIYEVQMGRNLAYVDESGRTFLFGSMYDMEARSDLTAARKTELG
IQDAPAPQQQRAEAPPIKWSDLPMADAMVRVIGKGERKLALFSDPDCPFCRQLERELEKL
DNVTIYTFLYPLASLHPGAPAKSENIWCAGEKARNKVWIDQMIGGKTPPAAKACATPLER
NVALGDSLNVRGTPTMFTSDGRRISGAMPAARIDAWLNAGK
Download sequence
Identical sequences A2SNI2
gi|124262886|ref|YP_001023356.1|NC_008826 WP_011831709.1.77188 gi|124262886|ref|YP_001023356.1| 420662.Mpe_B0346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]