SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 423368.SNSL254_A1922 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  423368.SNSL254_A1922
Domain Number - Region: 162-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0741
Family Calponin-homology domain, CH-domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 423368.SNSL254_A1922
Sequence length 421
Comment (Salmonella enterica serovar Newport SL254)
Sequence
MKNNIRFDLSDYLIHFFRDVNLETGSHIYLPEHCGFNNQHHACFIDAKYLLRLSLRSHKI
FSSWSYRNGQRTVYGDSPVVCFTDMPIAAYLETGVRRLERNEKIGLYAIVLPKEQMFNYG
ARPVIYGLDQHNNARCSQGRNGERILDETALPLIEQYRYVTYVPGKIDWTHEREWRWPYR
GDINNFLNHIKEYGIPENIESTPGFDFRSSEISGAGIIVPFAEDIPTVAHDILTLIDRGV
IGRNTFKFIIAVESLQSWTQLSEPGALLSCINDNTFEFESFFDLSASKVKNYADSINDYV
SELFSKKDFLNDSYAMEFGNAWVWIHDNQSQVVRALLQAGMIKVNKEGRYLLDVNLASVD
WPLRRKEAFASHVAGWLKHRFDIEAGRYSVRGKDDYDAIPSYETPLKDQHPFYNHTVNVD
W
Download sequence
Identical sequences A0A0H3BPJ2 A0A0R9NDB8 A0A0U0WUR5 A0A242UXS0
423368.SNSL254_A1922 ABEW01000001|CDS_209496-210761 CP001113|CDS_1882698-1881433 gi|538362379|ref|YP_008505664.1| gi|194444132|ref|YP_002041041.1| WP_000794387.1.100502 WP_000794387.1.100711 WP_000794387.1.101091 WP_000794387.1.101123 WP_000794387.1.10237 WP_000794387.1.10675 WP_000794387.1.12280 WP_000794387.1.1326 WP_000794387.1.15483 WP_000794387.1.15625 WP_000794387.1.15708 WP_000794387.1.158 WP_000794387.1.16331 WP_000794387.1.16941 WP_000794387.1.17098 WP_000794387.1.17285 WP_000794387.1.17447 WP_000794387.1.17629 WP_000794387.1.17991 WP_000794387.1.1897 WP_000794387.1.20119 WP_000794387.1.20391 WP_000794387.1.20425 WP_000794387.1.20695 WP_000794387.1.21792 WP_000794387.1.22514 WP_000794387.1.23736 WP_000794387.1.25036 WP_000794387.1.25498 WP_000794387.1.2554 WP_000794387.1.26269 WP_000794387.1.26363 WP_000794387.1.26426 WP_000794387.1.26856 WP_000794387.1.27419 WP_000794387.1.27522 WP_000794387.1.28612 WP_000794387.1.29924 WP_000794387.1.30356 WP_000794387.1.30909 WP_000794387.1.31210 WP_000794387.1.31251 WP_000794387.1.31476 WP_000794387.1.34259 WP_000794387.1.36157 WP_000794387.1.37558 WP_000794387.1.38199 WP_000794387.1.39576 WP_000794387.1.40648 WP_000794387.1.41440 WP_000794387.1.42605 WP_000794387.1.42797 WP_000794387.1.42829 WP_000794387.1.42887 WP_000794387.1.42923 WP_000794387.1.43875 WP_000794387.1.4405 WP_000794387.1.44438 WP_000794387.1.44440 WP_000794387.1.44443 WP_000794387.1.44607 WP_000794387.1.44633 WP_000794387.1.44678 WP_000794387.1.44833 WP_000794387.1.44950 WP_000794387.1.46250 WP_000794387.1.46406 WP_000794387.1.46444 WP_000794387.1.4671 WP_000794387.1.46730 WP_000794387.1.46749 WP_000794387.1.46961 WP_000794387.1.47067 WP_000794387.1.47714 WP_000794387.1.49102 WP_000794387.1.49226 WP_000794387.1.49931 WP_000794387.1.50003 WP_000794387.1.50007 WP_000794387.1.5009 WP_000794387.1.50374 WP_000794387.1.51162 WP_000794387.1.51285 WP_000794387.1.51308 WP_000794387.1.51514 WP_000794387.1.51611 WP_000794387.1.51700 WP_000794387.1.52528 WP_000794387.1.53534 WP_000794387.1.53694 WP_000794387.1.54061 WP_000794387.1.54082 WP_000794387.1.54827 WP_000794387.1.5517 WP_000794387.1.55223 WP_000794387.1.5523 WP_000794387.1.55545 WP_000794387.1.5555 WP_000794387.1.56247 WP_000794387.1.56393 WP_000794387.1.56905 WP_000794387.1.57149 WP_000794387.1.57357 WP_000794387.1.58249 WP_000794387.1.58301 WP_000794387.1.58442 WP_000794387.1.58836 WP_000794387.1.59294 WP_000794387.1.59928 WP_000794387.1.60015 WP_000794387.1.60746 WP_000794387.1.60794 WP_000794387.1.60838 WP_000794387.1.61233 WP_000794387.1.6210 WP_000794387.1.63043 WP_000794387.1.63234 WP_000794387.1.63824 WP_000794387.1.63992 WP_000794387.1.64242 WP_000794387.1.64266 WP_000794387.1.6572 WP_000794387.1.65795 WP_000794387.1.65838 WP_000794387.1.66167 WP_000794387.1.66235 WP_000794387.1.66534 WP_000794387.1.67184 WP_000794387.1.67374 WP_000794387.1.67924 WP_000794387.1.68591 WP_000794387.1.68818 WP_000794387.1.6882 WP_000794387.1.69288 WP_000794387.1.69785 WP_000794387.1.7014 WP_000794387.1.70326 WP_000794387.1.70523 WP_000794387.1.70547 WP_000794387.1.7134 WP_000794387.1.71368 WP_000794387.1.72382 WP_000794387.1.72827 WP_000794387.1.73144 WP_000794387.1.73669 WP_000794387.1.73956 WP_000794387.1.74117 WP_000794387.1.74996 WP_000794387.1.75793 WP_000794387.1.75884 WP_000794387.1.76024 WP_000794387.1.76208 WP_000794387.1.76301 WP_000794387.1.76738 WP_000794387.1.77271 WP_000794387.1.77543 WP_000794387.1.78602 WP_000794387.1.79032 WP_000794387.1.79297 WP_000794387.1.79302 WP_000794387.1.79642 WP_000794387.1.79966 WP_000794387.1.80674 WP_000794387.1.80750 WP_000794387.1.81321 WP_000794387.1.81667 WP_000794387.1.82895 WP_000794387.1.83061 WP_000794387.1.83119 WP_000794387.1.83897 WP_000794387.1.83960 WP_000794387.1.84683 WP_000794387.1.8552 WP_000794387.1.86335 WP_000794387.1.86982 WP_000794387.1.89452 WP_000794387.1.89965 WP_000794387.1.90866 WP_000794387.1.90984 WP_000794387.1.92047 WP_000794387.1.92439 WP_000794387.1.93596 WP_000794387.1.94967 WP_000794387.1.9516 WP_000794387.1.96798 WP_000794387.1.96902 WP_000794387.1.97043 WP_000794387.1.97109 WP_000794387.1.98446 WP_000794387.1.98513 WP_000794387.1.98634 WP_000794387.1.98947 WP_000794387.1.99040 gi|528819583|ref|YP_008360786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]