SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 426430.NWMN_1183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426430.NWMN_1183
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.39e-49
Family Ribonuclease PH domain 1-like 0.0000202
Further Details:      
 
Domain Number 2 Region: 298-491
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-47
Family Ribonuclease PH domain 1-like 0.0000138
Further Details:      
 
Domain Number 3 Region: 454-552
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-29
Family Ribonuclease PH domain 2-like 0.0000784
Further Details:      
 
Domain Number 4 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.46e-28
Family Ribonuclease PH domain 2-like 0.0026
Further Details:      
 
Domain Number 5 Region: 559-643
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.77e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 6 Region: 624-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.97e-19
Family Cold shock DNA-binding domain-like 0.00099
Further Details:      
 
Domain Number 7 Region: 239-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.63e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 426430.NWMN_1183
Sequence length 698
Comment (Staphylococcus aureus Newman)
Sequence
MSQEKKVFKTEWAGRSLTIETGQLAKQANGAVLVRYGDTVVLSTATASKEPRDGDFFPLT
VNYEEKMYAAGKIPGGFKKREGRPGDDATLTARLIDRPIRPLFPKGYKHDVQIMNMVLSA
DPDCSPQMAAMIGSSMALSVSDIPFQGPIAGVNVGYIDGKYIINPTVEEKEVSRLDLEVA
GHKDAVNMVEAGASEITEQEMLEAIFFGHEEIQRLVDFQQQIVDHIQPVKQEFIPAERDE
ALVERVKSLTEEKGLKETVLTFDKQQRDENLDNLKEEIVNEFIDEEDPENELLIKEVYAI
LNELVKEEVRRLIADEKIRPDGRKPDEIRPLDSEVGILPRTHGSGLFTRGQTQALSVLTL
GALGDYQLIDGLGPEEEKRFMHHYNFPNFSVGETGPVRAPGRREIGHGALGERALKYIIP
DTADFPYTIRIVSEVLESNGSSSQASICGSTLALMDAGVPIKAPVAGIAMGLVTREDSYT
ILTDIQGMEDALGDMDFKVAGTKEGITAIQMDIKIDGLTREIIEEALEQARRGRLEIMNH
MLQTIDQPRTELSAYAPKVVTMTIKPDKIRDVIGPGGKKINEIIDETGVKLDIEQDGTIF
IGAVDQAMINRAREIIEEITREAEVGQTYQATVKRIEKYGAFVGLFPGKDALLHISQISK
NRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRALEE
Download sequence
Identical sequences A0A0D1JD45 A0A0E0VNF2 A0A1E8WY50 A0A2H5ANG1 A5ISF8 A6QGH3 A6U193 A7X1Q8 A8Z3V4 Q2FHG4 Q2FZ20 Q5HGF7 Q7A5X7 Q99UJ8 T1Y8D6 W8UB98
gi|470218839|ref|YP_007619233.1| gi|470224627|ref|YP_007623206.1| gi|537442603|ref|YP_008485180.1| gi|521212114|ref|YP_008168460.1| gi|545637615|ref|YP_008587791.1| gi|404478615|ref|YP_006710045.1| gi|151221395|ref|YP_001332217.1| gi|387602551|ref|YP_005734072.1| gi|57651844|ref|YP_186150.1| gi|387150417|ref|YP_005741981.1| gi|379020984|ref|YP_005297646.1| WP_000076690.1.100013 WP_000076690.1.100041 WP_000076690.1.100049 WP_000076690.1.100057 WP_000076690.1.100067 WP_000076690.1.100072 WP_000076690.1.100084 WP_000076690.1.100088 WP_000076690.1.100090 WP_000076690.1.100094 WP_000076690.1.100117 WP_000076690.1.10014 WP_000076690.1.100154 WP_000076690.1.100171 WP_000076690.1.100184 WP_000076690.1.100189 WP_000076690.1.100235 WP_000076690.1.100265 WP_000076690.1.100272 WP_000076690.1.100298 WP_000076690.1.100307 WP_000076690.1.10032 WP_000076690.1.100335 WP_000076690.1.100347 WP_000076690.1.100357 WP_000076690.1.100366 WP_000076690.1.100391 WP_000076690.1.100399 WP_000076690.1.10041 WP_000076690.1.10046 WP_000076690.1.100464 WP_000076690.1.10050 WP_000076690.1.100534 WP_000076690.1.100535 WP_000076690.1.100551 WP_000076690.1.100562 WP_000076690.1.100582 WP_000076690.1.100596 WP_000076690.1.100618 WP_000076690.1.100631 WP_000076690.1.100647 WP_000076690.1.100668 WP_000076690.1.100678 WP_000076690.1.100693 WP_000076690.1.100699 WP_000076690.1.100704 WP_000076690.1.100719 WP_000076690.1.100726 WP_000076690.1.100761 WP_000076690.1.100768 WP_000076690.1.100823 WP_000076690.1.100832 WP_000076690.1.100834 WP_000076690.1.10085 WP_000076690.1.100860 WP_000076690.1.100888 WP_000076690.1.100903 WP_000076690.1.100920 WP_000076690.1.100934 WP_000076690.1.100963 WP_000076690.1.10097 WP_000076690.1.100981 WP_000076690.1.100987 WP_000076690.1.101002 WP_000076690.1.101017 WP_000076690.1.101019 WP_000076690.1.101027 WP_000076690.1.101055 WP_000076690.1.101068 WP_000076690.1.101071 WP_000076690.1.101072 WP_000076690.1.101084 WP_000076690.1.101103 WP_000076690.1.10111 WP_000076690.1.101142 WP_000076690.1.101160 WP_000076690.1.101177 WP_000076690.1.101192 WP_000076690.1.101217 WP_000076690.1.101240 WP_000076690.1.101262 WP_000076690.1.101327 WP_000076690.1.101352 WP_000076690.1.101375 WP_000076690.1.101379 WP_000076690.1.101393 WP_000076690.1.101397 WP_000076690.1.101414 WP_000076690.1.101440 WP_000076690.1.101441 WP_000076690.1.10148 WP_000076690.1.101490 WP_000076690.1.101495 WP_000076690.1.101505 WP_000076690.1.101511 WP_000076690.1.101566 WP_000076690.1.101567 WP_000076690.1.101570 WP_000076690.1.101615 WP_000076690.1.10165 WP_000076690.1.10166 WP_000076690.1.101661 WP_000076690.1.101670 WP_000076690.1.101691 WP_000076690.1.101704 WP_000076690.1.101725 WP_000076690.1.101728 WP_000076690.1.101745 WP_000076690.1.101778 WP_000076690.1.101788 WP_000076690.1.101813 WP_000076690.1.101820 WP_000076690.1.101821 WP_000076690.1.101825 WP_000076690.1.101852 WP_000076690.1.101902 WP_000076690.1.101906 WP_000076690.1.101922 WP_000076690.1.101943 WP_000076690.1.101950 WP_000076690.1.101999 WP_000076690.1.102065 WP_000076690.1.102070 WP_000076690.1.102084 WP_000076690.1.10209 WP_000076690.1.102096 WP_000076690.1.102123 WP_000076690.1.102126 WP_000076690.1.102130 WP_000076690.1.102132 WP_000076690.1.1022 WP_000076690.1.10232 WP_000076690.1.10238 WP_000076690.1.1025 WP_000076690.1.10274 WP_000076690.1.10301 WP_000076690.1.10306 WP_000076690.1.10308 WP_000076690.1.1031 WP_000076690.1.1032 WP_000076690.1.10343 WP_000076690.1.10355 WP_000076690.1.10358 WP_000076690.1.10397 WP_000076690.1.1043 WP_000076690.1.10436 WP_000076690.1.10469 WP_000076690.1.10478 WP_000076690.1.10481 WP_000076690.1.10503 WP_000076690.1.10526 WP_000076690.1.10542 WP_000076690.1.10543 WP_000076690.1.10565 WP_000076690.1.1060 WP_000076690.1.10614 WP_000076690.1.10617 WP_000076690.1.10624 WP_000076690.1.10679 WP_000076690.1.10707 WP_000076690.1.10726 WP_000076690.1.10742 WP_000076690.1.10749 WP_000076690.1.10751 WP_000076690.1.1077 WP_000076690.1.10783 WP_000076690.1.10785 WP_000076690.1.10823 WP_000076690.1.10843 WP_000076690.1.10858 WP_000076690.1.10919 WP_000076690.1.10928 WP_000076690.1.10942 WP_000076690.1.10950 WP_000076690.1.1097 WP_000076690.1.10976 WP_000076690.1.10979 WP_000076690.1.11001 WP_000076690.1.11067 WP_000076690.1.11069 WP_000076690.1.11073 WP_000076690.1.11083 WP_000076690.1.11084 WP_000076690.1.11129 WP_000076690.1.1115 WP_000076690.1.11162 WP_000076690.1.11188 WP_000076690.1.1120 WP_000076690.1.11220 WP_000076690.1.1124 WP_000076690.1.11261 WP_000076690.1.11281 WP_000076690.1.11282 WP_000076690.1.11286 WP_000076690.1.11287 WP_000076690.1.11294 WP_000076690.1.11322 WP_000076690.1.11333 WP_000076690.1.11348 WP_000076690.1.11353 WP_000076690.1.11377 WP_000076690.1.11378 WP_000076690.1.11403 WP_000076690.1.11407 WP_000076690.1.11447 WP_000076690.1.11451 WP_000076690.1.11463 WP_000076690.1.1147 WP_000076690.1.11475 WP_000076690.1.11488 WP_000076690.1.11492 WP_000076690.1.11494 WP_000076690.1.11504 WP_000076690.1.11513 WP_000076690.1.11525 WP_000076690.1.11556 WP_000076690.1.11558 WP_000076690.1.11571 WP_000076690.1.11592 WP_000076690.1.11611 WP_000076690.1.11625 WP_000076690.1.11640 WP_000076690.1.11646 WP_000076690.1.11663 WP_000076690.1.11665 WP_000076690.1.11692 WP_000076690.1.117 WP_000076690.1.1171 WP_000076690.1.11719 WP_000076690.1.11720 WP_000076690.1.11730 WP_000076690.1.11736 WP_000076690.1.11741 WP_000076690.1.11768 WP_000076690.1.11781 WP_000076690.1.11794 WP_000076690.1.11795 WP_000076690.1.11828 WP_000076690.1.11829 WP_000076690.1.11837 WP_000076690.1.11884 WP_000076690.1.11919 WP_000076690.1.11991 WP_000076690.1.12005 WP_000076690.1.12019 WP_000076690.1.12042 WP_000076690.1.1205 WP_000076690.1.12073 WP_000076690.1.1210 WP_000076690.1.12123 WP_000076690.1.12137 WP_000076690.1.12149 WP_000076690.1.12152 WP_000076690.1.12170 WP_000076690.1.12175 WP_000076690.1.12179 WP_000076690.1.12181 WP_000076690.1.12193 WP_000076690.1.12194 WP_000076690.1.12233 WP_000076690.1.12234 WP_000076690.1.12256 WP_000076690.1.12272 WP_000076690.1.12297 WP_000076690.1.12328 WP_000076690.1.12330 WP_000076690.1.12437 WP_000076690.1.12447 WP_000076690.1.12498 WP_000076690.1.12508 WP_000076690.1.1257 WP_000076690.1.12597 WP_000076690.1.12598 WP_000076690.1.12605 WP_000076690.1.12608 WP_000076690.1.12618 WP_000076690.1.12639 WP_000076690.1.12668 WP_000076690.1.12685 WP_000076690.1.12705 WP_000076690.1.12707 WP_000076690.1.12715 WP_000076690.1.12733 WP_000076690.1.12737 WP_000076690.1.12770 WP_000076690.1.12771 WP_000076690.1.12780 WP_000076690.1.12788 WP_000076690.1.12802 WP_000076690.1.12822 WP_000076690.1.12829 WP_000076690.1.12833 WP_000076690.1.12845 WP_000076690.1.12858 WP_000076690.1.12862 WP_000076690.1.12884 WP_000076690.1.12903 WP_000076690.1.12904 WP_000076690.1.12920 WP_000076690.1.12937 WP_000076690.1.12938 WP_000076690.1.12951 WP_000076690.1.13013 WP_000076690.1.13039 WP_000076690.1.13072 WP_000076690.1.13091 WP_000076690.1.13104 WP_000076690.1.13112 WP_000076690.1.13154 WP_000076690.1.13169 WP_000076690.1.13189 WP_000076690.1.13228 WP_000076690.1.13243 WP_000076690.1.13250 WP_000076690.1.13303 WP_000076690.1.13317 WP_000076690.1.13322 WP_000076690.1.13326 WP_000076690.1.13336 WP_000076690.1.13355 WP_000076690.1.13379 WP_000076690.1.13448 WP_000076690.1.13468 WP_000076690.1.1347 WP_000076690.1.13486 WP_000076690.1.13514 WP_000076690.1.13531 WP_000076690.1.13554 WP_000076690.1.13556 WP_000076690.1.13568 WP_000076690.1.13598 WP_000076690.1.13612 WP_000076690.1.13617 WP_000076690.1.13654 WP_000076690.1.13665 WP_000076690.1.13668 WP_000076690.1.13670 WP_000076690.1.13679 WP_000076690.1.13680 WP_000076690.1.13683 WP_000076690.1.13727 WP_000076690.1.13728 WP_000076690.1.13733 WP_000076690.1.1374 WP_000076690.1.13755 WP_000076690.1.13757 WP_000076690.1.13772 WP_000076690.1.13804 WP_000076690.1.13805 WP_000076690.1.13870 WP_000076690.1.13879 WP_000076690.1.13897 WP_000076690.1.13914 WP_000076690.1.13933 WP_000076690.1.13940 WP_000076690.1.13948 WP_000076690.1.13983 WP_000076690.1.13986 WP_000076690.1.13987 WP_000076690.1.14010 WP_000076690.1.14025 WP_000076690.1.14071 WP_000076690.1.14097 WP_000076690.1.14112 WP_000076690.1.14143 WP_000076690.1.14153 WP_000076690.1.14163 WP_000076690.1.1420 WP_000076690.1.14201 WP_000076690.1.14233 WP_000076690.1.1425 WP_000076690.1.1426 WP_000076690.1.1429 WP_000076690.1.14298 WP_000076690.1.14305 WP_000076690.1.14337 WP_000076690.1.14342 WP_000076690.1.14349 WP_000076690.1.14358 WP_000076690.1.14364 WP_000076690.1.14365 WP_000076690.1.14366 WP_000076690.1.14394 WP_000076690.1.14397 WP_000076690.1.14412 WP_000076690.1.14418 WP_000076690.1.14475 WP_000076690.1.14546 WP_000076690.1.14577 WP_000076690.1.14596 WP_000076690.1.14639 WP_000076690.1.14665 WP_000076690.1.14666 WP_000076690.1.14681 WP_000076690.1.147 WP_000076690.1.1471 WP_000076690.1.14729 WP_000076690.1.14734 WP_000076690.1.14744 WP_000076690.1.14747 WP_000076690.1.1477 WP_000076690.1.14770 WP_000076690.1.14774 WP_000076690.1.14782 WP_000076690.1.14790 WP_000076690.1.14809 WP_000076690.1.14825 WP_000076690.1.14846 WP_000076690.1.14868 WP_000076690.1.14869 WP_000076690.1.14874 WP_000076690.1.14888 WP_000076690.1.1490 WP_000076690.1.14902 WP_000076690.1.14967 WP_000076690.1.14970 WP_000076690.1.14987 WP_000076690.1.15000 WP_000076690.1.15015 WP_000076690.1.15029 WP_000076690.1.15108 WP_000076690.1.15173 WP_000076690.1.15185 WP_000076690.1.1520 WP_000076690.1.15201 WP_000076690.1.15206 WP_000076690.1.15228 WP_000076690.1.1525 WP_000076690.1.15255 WP_000076690.1.15263 WP_000076690.1.15268 WP_000076690.1.15269 WP_000076690.1.15278 WP_000076690.1.15294 WP_000076690.1.15296 WP_000076690.1.15329 WP_000076690.1.15399 WP_000076690.1.15409 WP_000076690.1.15421 WP_000076690.1.15438 WP_000076690.1.1545 WP_000076690.1.15489 WP_000076690.1.15505 WP_000076690.1.15507 WP_000076690.1.15533 WP_000076690.1.15544 WP_000076690.1.15546 WP_000076690.1.15572 WP_000076690.1.1558 WP_000076690.1.15590 WP_000076690.1.15591 WP_000076690.1.1564 WP_000076690.1.15679 WP_000076690.1.15687 WP_000076690.1.15691 WP_000076690.1.15706 WP_000076690.1.15722 WP_000076690.1.15785 WP_000076690.1.1579 WP_000076690.1.15812 WP_000076690.1.15818 WP_000076690.1.15819 WP_000076690.1.1583 WP_000076690.1.15838 WP_000076690.1.1586 WP_000076690.1.15883 WP_000076690.1.15892 WP_000076690.1.15897 WP_000076690.1.15898 WP_000076690.1.159 WP_000076690.1.15920 WP_000076690.1.15921 WP_000076690.1.15925 WP_000076690.1.15928 WP_000076690.1.15939 WP_000076690.1.15957 WP_000076690.1.15972 WP_000076690.1.1600 WP_000076690.1.16018 WP_000076690.1.1606 WP_000076690.1.16068 WP_000076690.1.16096 WP_000076690.1.16112 WP_000076690.1.16114 WP_000076690.1.16140 WP_000076690.1.16157 WP_000076690.1.16173 WP_000076690.1.16195 WP_000076690.1.16203 WP_000076690.1.16213 WP_000076690.1.16223 WP_000076690.1.1623 WP_000076690.1.16237 WP_000076690.1.16251 WP_000076690.1.16265 WP_000076690.1.16276 WP_000076690.1.16311 WP_000076690.1.16362 WP_000076690.1.16372 WP_000076690.1.16395 WP_000076690.1.16399 WP_000076690.1.16407 WP_000076690.1.16436 WP_000076690.1.16458 WP_000076690.1.16554 WP_000076690.1.16569 WP_000076690.1.16589 WP_000076690.1.16603 WP_000076690.1.16617 WP_000076690.1.16628 WP_000076690.1.16632 WP_000076690.1.16639 WP_000076690.1.1665 WP_000076690.1.16651 WP_000076690.1.16653 WP_000076690.1.16672 WP_000076690.1.16679 WP_000076690.1.16693 WP_000076690.1.16703 WP_000076690.1.16747 WP_000076690.1.16757 WP_000076690.1.16761 WP_000076690.1.16768 WP_000076690.1.16770 WP_000076690.1.16776 WP_000076690.1.16794 WP_000076690.1.16815 WP_000076690.1.16824 WP_000076690.1.16880 WP_000076690.1.16882 WP_000076690.1.16892 WP_000076690.1.16920 WP_000076690.1.16925 WP_000076690.1.16946 WP_000076690.1.16969 WP_000076690.1.16986 WP_000076690.1.17038 WP_000076690.1.17080 WP_000076690.1.17104 WP_000076690.1.17122 WP_000076690.1.17132 WP_000076690.1.17137 WP_000076690.1.17139 WP_000076690.1.17143 WP_000076690.1.17156 WP_000076690.1.17157 WP_000076690.1.17169 WP_000076690.1.17180 WP_000076690.1.17201 WP_000076690.1.17210 WP_000076690.1.17231 WP_000076690.1.17234 WP_000076690.1.17240 WP_000076690.1.17249 WP_000076690.1.17256 WP_000076690.1.1729 WP_000076690.1.17309 WP_000076690.1.17320 WP_000076690.1.17327 WP_000076690.1.1736 WP_000076690.1.1741 WP_000076690.1.17419 WP_000076690.1.17450 WP_000076690.1.17454 WP_000076690.1.17485 WP_000076690.1.1751 WP_000076690.1.17529 WP_000076690.1.17531 WP_000076690.1.1756 WP_000076690.1.17569 WP_000076690.1.17581 WP_000076690.1.17590 WP_000076690.1.17643 WP_000076690.1.1765 WP_000076690.1.17650 WP_000076690.1.17657 WP_000076690.1.17666 WP_000076690.1.17671 WP_000076690.1.17676 WP_000076690.1.17717 WP_000076690.1.17718 WP_000076690.1.17725 WP_000076690.1.17737 WP_000076690.1.17770 WP_000076690.1.17796 WP_000076690.1.17818 WP_000076690.1.17832 WP_000076690.1.17834 WP_000076690.1.17845 WP_000076690.1.17847 WP_000076690.1.17853 WP_000076690.1.17859 WP_000076690.1.17876 WP_000076690.1.17909 WP_000076690.1.17922 WP_000076690.1.17929 WP_000076690.1.17943 WP_000076690.1.17951 WP_000076690.1.17974 WP_000076690.1.17987 WP_000076690.1.18011 WP_000076690.1.18035 WP_000076690.1.18069 WP_000076690.1.18074 WP_000076690.1.18105 WP_000076690.1.18113 WP_000076690.1.18140 WP_000076690.1.18153 WP_000076690.1.18197 WP_000076690.1.18203 WP_000076690.1.18237 WP_000076690.1.18248 WP_000076690.1.18261 WP_000076690.1.18273 WP_000076690.1.18283 WP_000076690.1.18288 WP_000076690.1.1829 WP_000076690.1.18290 WP_000076690.1.18301 WP_000076690.1.18309 WP_000076690.1.18310 WP_000076690.1.18320 WP_000076690.1.1835 WP_000076690.1.18360 WP_000076690.1.18412 WP_000076690.1.18424 WP_000076690.1.18429 WP_000076690.1.18437 WP_000076690.1.18451 WP_000076690.1.1847 WP_000076690.1.18487 WP_000076690.1.185 WP_000076690.1.18506 WP_000076690.1.18507 WP_000076690.1.1851 WP_000076690.1.18516 WP_000076690.1.18527 WP_000076690.1.18529 WP_000076690.1.18539 WP_000076690.1.18560 WP_000076690.1.18562 WP_000076690.1.18570 WP_000076690.1.18590 WP_000076690.1.18591 WP_000076690.1.18611 WP_000076690.1.18632 WP_000076690.1.18656 WP_000076690.1.18658 WP_000076690.1.18668 WP_000076690.1.18679 WP_000076690.1.18719 WP_000076690.1.18741 WP_000076690.1.18758 WP_000076690.1.18777 WP_000076690.1.18792 WP_000076690.1.18809 WP_000076690.1.18818 WP_000076690.1.18819 WP_000076690.1.18830 WP_000076690.1.18834 WP_000076690.1.18836 WP_000076690.1.18879 WP_000076690.1.18882 WP_000076690.1.18918 WP_000076690.1.1892 WP_000076690.1.18938 WP_000076690.1.18965 WP_000076690.1.18974 WP_000076690.1.18987 WP_000076690.1.19009 WP_000076690.1.1901 WP_000076690.1.19014 WP_000076690.1.19027 WP_000076690.1.19052 WP_000076690.1.19082 WP_000076690.1.19109 WP_000076690.1.1911 WP_000076690.1.19179 WP_000076690.1.192 WP_000076690.1.19259 WP_000076690.1.19272 WP_000076690.1.19301 WP_000076690.1.19306 WP_000076690.1.19322 WP_000076690.1.19375 WP_000076690.1.19377 WP_000076690.1.19390 WP_000076690.1.19411 WP_000076690.1.1943 WP_000076690.1.19430 WP_000076690.1.19444 WP_000076690.1.19450 WP_000076690.1.19509 WP_000076690.1.19555 WP_000076690.1.19575 WP_000076690.1.19577 WP_000076690.1.19611 WP_000076690.1.1962 WP_000076690.1.1964 WP_000076690.1.19643 WP_000076690.1.19701 WP_000076690.1.19725 WP_000076690.1.19732 WP_000076690.1.19733 WP_000076690.1.1974 WP_000076690.1.19748 WP_000076690.1.1975 WP_000076690.1.19759 WP_000076690.1.19765 WP_000076690.1.19775 WP_000076690.1.19792 WP_000076690.1.19816 WP_000076690.1.19848 WP_000076690.1.19881 WP_000076690.1.19891 WP_000076690.1.19904 WP_000076690.1.19912 WP_000076690.1.19921 WP_000076690.1.19980 WP_000076690.1.19981 WP_000076690.1.19982 WP_000076690.1.20006 WP_000076690.1.20049 WP_000076690.1.20052 WP_000076690.1.20057 WP_000076690.1.2007 WP_000076690.1.20078 WP_000076690.1.2008 WP_000076690.1.20090 WP_000076690.1.20100 WP_000076690.1.20101 WP_000076690.1.2013 WP_000076690.1.20155 WP_000076690.1.20156 WP_000076690.1.20160 WP_000076690.1.20161 WP_000076690.1.20167 WP_000076690.1.20177 WP_000076690.1.20191 WP_000076690.1.20210 WP_000076690.1.20214 WP_000076690.1.20235 WP_000076690.1.20245 WP_000076690.1.2029 WP_000076690.1.20324 WP_000076690.1.20340 WP_000076690.1.20354 WP_000076690.1.20386 WP_000076690.1.20394 WP_000076690.1.20398 WP_000076690.1.20399 WP_000076690.1.20411 WP_000076690.1.20447 WP_000076690.1.20473 WP_000076690.1.20479 WP_000076690.1.20487 WP_000076690.1.20550 WP_000076690.1.20554 WP_000076690.1.20579 WP_000076690.1.20585 WP_000076690.1.20611 WP_000076690.1.20619 WP_000076690.1.20620 WP_000076690.1.20736 WP_000076690.1.20772 WP_000076690.1.20796 WP_000076690.1.20821 WP_000076690.1.20833 WP_000076690.1.20838 WP_000076690.1.20846 WP_000076690.1.20860 WP_000076690.1.20867 WP_000076690.1.20878 WP_000076690.1.20913 WP_000076690.1.20922 WP_000076690.1.20935 WP_000076690.1.20939 WP_000076690.1.20945 WP_000076690.1.20971 WP_000076690.1.20975 WP_000076690.1.20979 WP_000076690.1.21009 WP_000076690.1.21013 WP_000076690.1.21054 WP_000076690.1.21056 WP_000076690.1.21066 WP_000076690.1.21078 WP_000076690.1.21080 WP_000076690.1.21102 WP_000076690.1.21109 WP_000076690.1.21111 WP_000076690.1.21154 WP_000076690.1.21183 WP_000076690.1.2119 WP_000076690.1.21257 WP_000076690.1.21272 WP_000076690.1.2128 WP_000076690.1.21312 WP_000076690.1.21313 WP_000076690.1.21339 WP_000076690.1.2135 WP_000076690.1.21356 WP_000076690.1.21359 WP_000076690.1.21375 WP_000076690.1.21379 WP_000076690.1.21386 WP_000076690.1.21393 WP_000076690.1.21402 WP_000076690.1.21412 WP_000076690.1.21449 WP_000076690.1.21458 WP_000076690.1.21464 WP_000076690.1.21465 WP_000076690.1.21477 WP_000076690.1.21480 WP_000076690.1.21500 WP_000076690.1.21514 WP_000076690.1.2154 WP_000076690.1.21572 WP_000076690.1.21583 WP_000076690.1.2159 WP_000076690.1.2160 WP_000076690.1.21601 WP_000076690.1.21636 WP_000076690.1.21679 WP_000076690.1.21712 WP_000076690.1.21724 WP_000076690.1.21746 WP_000076690.1.21763 WP_000076690.1.2178 WP_000076690.1.21787 WP_000076690.1.21820 WP_000076690.1.21830 WP_000076690.1.21890 WP_000076690.1.21894 WP_000076690.1.21901 WP_000076690.1.21954 WP_000076690.1.21988 WP_000076690.1.22022 WP_000076690.1.22027 WP_000076690.1.22045 WP_000076690.1.22082 WP_000076690.1.22111 WP_000076690.1.22163 WP_000076690.1.22165 WP_000076690.1.22170 WP_000076690.1.22174 WP_000076690.1.22177 WP_000076690.1.22197 WP_000076690.1.22227 WP_000076690.1.22246 WP_000076690.1.22302 WP_000076690.1.22307 WP_000076690.1.22344 WP_000076690.1.22367 WP_000076690.1.22400 WP_000076690.1.22418 WP_000076690.1.22493 WP_000076690.1.22526 WP_000076690.1.22533 WP_000076690.1.22547 WP_000076690.1.22551 WP_000076690.1.22559 WP_000076690.1.22650 WP_000076690.1.22657 WP_000076690.1.22696 WP_000076690.1.22702 WP_000076690.1.22709 WP_000076690.1.22714 WP_000076690.1.22727 WP_000076690.1.22730 WP_000076690.1.22731 WP_000076690.1.22738 WP_000076690.1.22739 WP_000076690.1.22789 WP_000076690.1.22790 WP_000076690.1.22792 WP_000076690.1.2280 WP_000076690.1.22803 WP_000076690.1.22808 WP_000076690.1.22811 WP_000076690.1.22843 WP_000076690.1.22853 WP_000076690.1.22859 WP_000076690.1.22869 WP_000076690.1.22890 WP_000076690.1.22924 WP_000076690.1.22969 WP_000076690.1.22975 WP_000076690.1.22994 WP_000076690.1.23004 WP_000076690.1.23008 WP_000076690.1.23061 WP_000076690.1.23082 WP_000076690.1.23103 WP_000076690.1.23121 WP_000076690.1.23130 WP_000076690.1.23132 WP_000076690.1.23133 WP_000076690.1.23152 WP_000076690.1.23161 WP_000076690.1.23185 WP_000076690.1.23194 WP_000076690.1.23217 WP_000076690.1.23228 WP_000076690.1.23238 WP_000076690.1.23244 WP_000076690.1.2327 WP_000076690.1.23275 WP_000076690.1.23288 WP_000076690.1.23381 WP_000076690.1.23413 WP_000076690.1.23420 WP_000076690.1.23431 WP_000076690.1.23439 WP_000076690.1.23449 WP_000076690.1.23450 WP_000076690.1.23491 WP_000076690.1.23516 WP_000076690.1.23531 WP_000076690.1.23541 WP_000076690.1.23544 WP_000076690.1.23557 WP_000076690.1.23572 WP_000076690.1.23586 WP_000076690.1.23613 WP_000076690.1.23617 WP_000076690.1.23626 WP_000076690.1.23630 WP_000076690.1.23644 WP_000076690.1.2365 WP_000076690.1.23690 WP_000076690.1.23710 WP_000076690.1.23796 WP_000076690.1.23809 WP_000076690.1.2382 WP_000076690.1.23822 WP_000076690.1.23842 WP_000076690.1.23849 WP_000076690.1.23856 WP_000076690.1.2389 WP_000076690.1.23900 WP_000076690.1.23907 WP_000076690.1.23935 WP_000076690.1.23944 WP_000076690.1.23956 WP_000076690.1.23972 WP_000076690.1.23995 WP_000076690.1.23998 WP_000076690.1.24000 WP_000076690.1.24129 WP_000076690.1.24148 WP_000076690.1.24167 WP_000076690.1.2420 WP_000076690.1.24207 WP_000076690.1.24213 WP_000076690.1.2423 WP_000076690.1.24241 WP_000076690.1.24263 WP_000076690.1.2427 WP_000076690.1.24277 WP_000076690.1.24279 WP_000076690.1.24343 WP_000076690.1.24364 WP_000076690.1.24416 WP_000076690.1.24418 WP_000076690.1.2442 WP_000076690.1.24436 WP_000076690.1.24437 WP_000076690.1.24443 WP_000076690.1.24478 WP_000076690.1.2450 WP_000076690.1.2458 WP_000076690.1.24589 WP_000076690.1.24596 WP_000076690.1.24602 WP_000076690.1.24617 WP_000076690.1.24631 WP_000076690.1.24679 WP_000076690.1.24681 WP_000076690.1.24745 WP_000076690.1.24781 WP_000076690.1.2480 WP_000076690.1.24802 WP_000076690.1.24823 WP_000076690.1.24855 WP_000076690.1.24891 WP_000076690.1.24918 WP_000076690.1.2497 WP_000076690.1.25007 WP_000076690.1.2501 WP_000076690.1.25012 WP_000076690.1.25029 WP_000076690.1.2506 WP_000076690.1.25070 WP_000076690.1.25083 WP_000076690.1.25092 WP_000076690.1.25098 WP_000076690.1.25115 WP_000076690.1.25117 WP_000076690.1.25145 WP_000076690.1.25167 WP_000076690.1.25170 WP_000076690.1.25209 WP_000076690.1.2522 WP_000076690.1.25287 WP_000076690.1.25361 WP_000076690.1.25438 WP_000076690.1.2544 WP_000076690.1.25459 WP_000076690.1.25469 WP_000076690.1.25479 WP_000076690.1.25488 WP_000076690.1.25489 WP_000076690.1.25511 WP_000076690.1.2552 WP_000076690.1.25557 WP_000076690.1.25567 WP_000076690.1.25593 WP_000076690.1.25595 WP_000076690.1.25621 WP_000076690.1.25623 WP_000076690.1.25634 WP_000076690.1.257 WP_000076690.1.25721 WP_000076690.1.25737 WP_000076690.1.25758 WP_000076690.1.25770 WP_000076690.1.25776 WP_000076690.1.25779 WP_000076690.1.2579 WP_000076690.1.25802 WP_000076690.1.25820 WP_000076690.1.25840 WP_000076690.1.25852 WP_000076690.1.25856 WP_000076690.1.25857 WP_000076690.1.25867 WP_000076690.1.25868 WP_000076690.1.25881 WP_000076690.1.25891 WP_000076690.1.25910 WP_000076690.1.2592 WP_000076690.1.25924 WP_000076690.1.2593 WP_000076690.1.25930 WP_000076690.1.25955 WP_000076690.1.26006 WP_000076690.1.26015 WP_000076690.1.26033 WP_000076690.1.26039 WP_000076690.1.2608 WP_000076690.1.26086 WP_000076690.1.26106 WP_000076690.1.26143 WP_000076690.1.26169 WP_000076690.1.262 WP_000076690.1.2621 WP_000076690.1.26226 WP_000076690.1.26255 WP_000076690.1.26266 WP_000076690.1.26276 WP_000076690.1.26290 WP_000076690.1.26293 WP_000076690.1.26298 WP_000076690.1.26306 WP_000076690.1.26307 WP_000076690.1.26314 WP_000076690.1.26318 WP_000076690.1.26340 WP_000076690.1.26345 WP_000076690.1.26346 WP_000076690.1.26354 WP_000076690.1.26359 WP_000076690.1.26364 WP_000076690.1.26370 WP_000076690.1.26397 WP_000076690.1.26399 WP_000076690.1.26404 WP_000076690.1.26405 WP_000076690.1.2643 WP_000076690.1.2645 WP_000076690.1.26481 WP_000076690.1.26506 WP_000076690.1.2656 WP_000076690.1.2658 WP_000076690.1.26584 WP_000076690.1.2661 WP_000076690.1.26626 WP_000076690.1.2664 WP_000076690.1.26662 WP_000076690.1.26663 WP_000076690.1.26677 WP_000076690.1.26692 WP_000076690.1.26726 WP_000076690.1.2673 WP_000076690.1.26733 WP_000076690.1.26751 WP_000076690.1.26771 WP_000076690.1.26772 WP_000076690.1.26790 WP_000076690.1.26804 WP_000076690.1.2684 WP_000076690.1.26840 WP_000076690.1.26850 WP_000076690.1.26865 WP_000076690.1.2687 WP_000076690.1.26884 WP_000076690.1.2689 WP_000076690.1.26903 WP_000076690.1.26905 WP_000076690.1.26927 WP_000076690.1.26929 WP_000076690.1.26938 WP_000076690.1.26944 WP_000076690.1.26958 WP_000076690.1.26963 WP_000076690.1.2697 WP_000076690.1.27013 WP_000076690.1.27042 WP_000076690.1.27053 WP_000076690.1.27080 WP_000076690.1.27083 WP_000076690.1.27154 WP_000076690.1.27166 WP_000076690.1.27168 WP_000076690.1.27170 WP_000076690.1.27182 WP_000076690.1.2719 WP_000076690.1.27199 WP_000076690.1.27246 WP_000076690.1.2725 WP_000076690.1.27262 WP_000076690.1.27293 WP_000076690.1.27294 WP_000076690.1.27311 WP_000076690.1.27323 WP_000076690.1.27333 WP_000076690.1.2734 WP_000076690.1.27345 WP_000076690.1.27379 WP_000076690.1.27387 WP_000076690.1.27447 WP_000076690.1.27455 WP_000076690.1.27456 WP_000076690.1.27457 WP_000076690.1.27467 WP_000076690.1.27468 WP_000076690.1.27516 WP_000076690.1.2753 WP_000076690.1.27539 WP_000076690.1.27551 WP_000076690.1.27562 WP_000076690.1.2759 WP_000076690.1.27590 WP_000076690.1.27608 WP_000076690.1.27614 WP_000076690.1.27615 WP_000076690.1.27621 WP_000076690.1.27628 WP_000076690.1.27646 WP_000076690.1.27654 WP_000076690.1.27667 WP_000076690.1.27670 WP_000076690.1.2768 WP_000076690.1.27689 WP_000076690.1.27717 WP_000076690.1.27739 WP_000076690.1.27744 WP_000076690.1.27748 WP_000076690.1.27765 WP_000076690.1.27793 WP_000076690.1.27799 WP_000076690.1.27817 WP_000076690.1.27830 WP_000076690.1.27834 WP_000076690.1.27854 WP_000076690.1.27929 WP_000076690.1.2795 WP_000076690.1.27950 WP_000076690.1.27953 WP_000076690.1.27972 WP_000076690.1.28007 WP_000076690.1.28016 WP_000076690.1.28025 WP_000076690.1.28063 WP_000076690.1.28071 WP_000076690.1.28079 WP_000076690.1.28081 WP_000076690.1.28088 WP_000076690.1.28091 WP_000076690.1.28105 WP_000076690.1.28117 WP_000076690.1.28138 WP_000076690.1.28147 WP_000076690.1.28158 WP_000076690.1.28173 WP_000076690.1.28191 WP_000076690.1.28207 WP_000076690.1.28213 WP_000076690.1.28226 WP_000076690.1.28230 WP_000076690.1.28253 WP_000076690.1.28257 WP_000076690.1.28274 WP_000076690.1.28315 WP_000076690.1.28319 WP_000076690.1.28347 WP_000076690.1.28358 WP_000076690.1.28360 WP_000076690.1.28376 WP_000076690.1.28381 WP_000076690.1.28400 WP_000076690.1.28430 WP_000076690.1.28498 WP_000076690.1.28502 WP_000076690.1.2852 WP_000076690.1.28526 WP_000076690.1.28527 WP_000076690.1.28532 WP_000076690.1.28564 WP_000076690.1.28578 WP_000076690.1.28580 WP_000076690.1.28605 WP_000076690.1.28614 WP_000076690.1.2862 WP_000076690.1.28629 WP_000076690.1.28650 WP_000076690.1.28652 WP_000076690.1.28672 WP_000076690.1.28675 WP_000076690.1.28710 WP_000076690.1.28720 WP_000076690.1.28725 WP_000076690.1.28763 WP_000076690.1.28784 WP_000076690.1.28785 WP_000076690.1.28862 WP_000076690.1.28871 WP_000076690.1.28887 WP_000076690.1.28909 WP_000076690.1.2891 WP_000076690.1.28925 WP_000076690.1.28933 WP_000076690.1.28934 WP_000076690.1.28960 WP_000076690.1.28970 WP_000076690.1.28981 WP_000076690.1.28987 WP_000076690.1.29052 WP_000076690.1.29060 WP_000076690.1.29090 WP_000076690.1.29107 WP_000076690.1.29112 WP_000076690.1.2913 WP_000076690.1.29155 WP_000076690.1.29166 WP_000076690.1.29187 WP_000076690.1.29188 WP_000076690.1.29207 WP_000076690.1.29226 WP_000076690.1.29242 WP_000076690.1.29244 WP_000076690.1.29263 WP_000076690.1.29272 WP_000076690.1.29276 WP_000076690.1.29282 WP_000076690.1.29285 WP_000076690.1.29312 WP_000076690.1.29329 WP_000076690.1.29368 WP_000076690.1.29372 WP_000076690.1.29373 WP_000076690.1.29381 WP_000076690.1.29395 WP_000076690.1.29420 WP_000076690.1.29445 WP_000076690.1.29468 WP_000076690.1.29511 WP_000076690.1.29522 WP_000076690.1.29541 WP_000076690.1.29561 WP_000076690.1.2957 WP_000076690.1.29596 WP_000076690.1.29644 WP_000076690.1.29676 WP_000076690.1.2972 WP_000076690.1.29731 WP_000076690.1.29736 WP_000076690.1.29744 WP_000076690.1.2975 WP_000076690.1.29758 WP_000076690.1.29781 WP_000076690.1.29788 WP_000076690.1.29805 WP_000076690.1.2981 WP_000076690.1.2983 WP_000076690.1.29862 WP_000076690.1.29885 WP_000076690.1.29902 WP_000076690.1.29905 WP_000076690.1.29918 WP_000076690.1.29963 WP_000076690.1.2997 WP_000076690.1.29981 WP_000076690.1.29982 WP_000076690.1.30012 WP_000076690.1.30023 WP_000076690.1.30033 WP_000076690.1.30047 WP_000076690.1.30051 WP_000076690.1.30057 WP_000076690.1.30089 WP_000076690.1.30095 WP_000076690.1.30100 WP_000076690.1.30115 WP_000076690.1.30130 WP_000076690.1.30152 WP_000076690.1.30176 WP_000076690.1.30191 WP_000076690.1.30197 WP_000076690.1.30204 WP_000076690.1.30209 WP_000076690.1.30249 WP_000076690.1.30262 WP_000076690.1.30268 WP_000076690.1.30274 WP_000076690.1.3029 WP_000076690.1.30302 WP_000076690.1.30307 WP_000076690.1.30328 WP_000076690.1.30333 WP_000076690.1.30364 WP_000076690.1.30367 WP_000076690.1.30376 WP_000076690.1.30381 WP_000076690.1.30385 WP_000076690.1.30418 WP_000076690.1.30422 WP_000076690.1.30458 WP_000076690.1.30477 WP_000076690.1.30508 WP_000076690.1.30530 WP_000076690.1.30531 WP_000076690.1.30560 WP_000076690.1.30566 WP_000076690.1.30568 WP_000076690.1.30622 WP_000076690.1.30623 WP_000076690.1.30645 WP_000076690.1.30646 WP_000076690.1.30648 WP_000076690.1.30650 WP_000076690.1.30652 WP_000076690.1.30666 WP_000076690.1.30702 WP_000076690.1.30720 WP_000076690.1.30726 WP_000076690.1.30758 WP_000076690.1.30763 WP_000076690.1.3077 WP_000076690.1.30845 WP_000076690.1.30846 WP_000076690.1.30847 WP_000076690.1.30854 WP_000076690.1.30862 WP_000076690.1.30863 WP_000076690.1.30874 WP_000076690.1.30878 WP_000076690.1.30880 WP_000076690.1.30889 WP_000076690.1.30911 WP_000076690.1.30915 WP_000076690.1.30916 WP_000076690.1.30928 WP_000076690.1.30962 WP_000076690.1.3097 WP_000076690.1.30970 WP_000076690.1.30971 WP_000076690.1.30998 WP_000076690.1.31005 WP_000076690.1.31022 WP_000076690.1.31037 WP_000076690.1.31039 WP_000076690.1.31041 WP_000076690.1.31048 WP_000076690.1.31065 WP_000076690.1.31068 WP_000076690.1.31091 WP_000076690.1.31113 WP_000076690.1.31124 WP_000076690.1.31176 WP_000076690.1.31194 WP_000076690.1.31202 WP_000076690.1.31206 WP_000076690.1.31232 WP_000076690.1.31315 WP_000076690.1.31339 WP_000076690.1.31355 WP_000076690.1.31376 WP_000076690.1.31377 WP_000076690.1.31437 WP_000076690.1.31442 WP_000076690.1.31462 WP_000076690.1.31478 WP_000076690.1.31479 WP_000076690.1.315 WP_000076690.1.31529 WP_000076690.1.31539 WP_000076690.1.31567 WP_000076690.1.31568 WP_000076690.1.31589 WP_000076690.1.31605 WP_000076690.1.31611 WP_000076690.1.31638 WP_000076690.1.31642 WP_000076690.1.31647 WP_000076690.1.31653 WP_000076690.1.31667 WP_000076690.1.31686 WP_000076690.1.31701 WP_000076690.1.31743 WP_000076690.1.31753 WP_000076690.1.31787 WP_000076690.1.31797 WP_000076690.1.31816 WP_000076690.1.31817 WP_000076690.1.31827 WP_000076690.1.31828 WP_000076690.1.31842 WP_000076690.1.3188 WP_000076690.1.31892 WP_000076690.1.31897 WP_000076690.1.31925 WP_000076690.1.31943 WP_000076690.1.31949 WP_000076690.1.31990 WP_000076690.1.31994 WP_000076690.1.31997 WP_000076690.1.32003 WP_000076690.1.32005 WP_000076690.1.32029 WP_000076690.1.32059 WP_000076690.1.32067 WP_000076690.1.32095 WP_000076690.1.32118 WP_000076690.1.32122 WP_000076690.1.32125 WP_000076690.1.32160 WP_000076690.1.32167 WP_000076690.1.32207 WP_000076690.1.32217 WP_000076690.1.32244 WP_000076690.1.32248 WP_000076690.1.32281 WP_000076690.1.3229 WP_000076690.1.32295 WP_000076690.1.32301 WP_000076690.1.32339 WP_000076690.1.32348 WP_000076690.1.32365 WP_000076690.1.32384 WP_000076690.1.32405 WP_000076690.1.3242 WP_000076690.1.3244 WP_000076690.1.32464 WP_000076690.1.32474 WP_000076690.1.32481 WP_000076690.1.32483 WP_000076690.1.32497 WP_000076690.1.32514 WP_000076690.1.32517 WP_000076690.1.32534 WP_000076690.1.32546 WP_000076690.1.32565 WP_000076690.1.32588 WP_000076690.1.32599 WP_000076690.1.32607 WP_000076690.1.32634 WP_000076690.1.32645 WP_000076690.1.32739 WP_000076690.1.32746 WP_000076690.1.32761 WP_000076690.1.32763 WP_000076690.1.32764 WP_000076690.1.32770 WP_000076690.1.32800 WP_000076690.1.32829 WP_000076690.1.32839 WP_000076690.1.32921 WP_000076690.1.32928 WP_000076690.1.3293 WP_000076690.1.32939 WP_000076690.1.32954 WP_000076690.1.32987 WP_000076690.1.3299 WP_000076690.1.33029 WP_000076690.1.33038 WP_000076690.1.33048 WP_000076690.1.3306 WP_000076690.1.33108 WP_000076690.1.33110 WP_000076690.1.33123 WP_000076690.1.33147 WP_000076690.1.3316 WP_000076690.1.33212 WP_000076690.1.33213 WP_000076690.1.33250 WP_000076690.1.33252 WP_000076690.1.33255 WP_000076690.1.33266 WP_000076690.1.33296 WP_000076690.1.33307 WP_000076690.1.33322 WP_000076690.1.33335 WP_000076690.1.3335 WP_000076690.1.33350 WP_000076690.1.33357 WP_000076690.1.3338 WP_000076690.1.33388 WP_000076690.1.33394 WP_000076690.1.33416 WP_000076690.1.3342 WP_000076690.1.33426 WP_000076690.1.3343 WP_000076690.1.33432 WP_000076690.1.33463 WP_000076690.1.33468 WP_000076690.1.3347 WP_000076690.1.33483 WP_000076690.1.33484 WP_000076690.1.33507 WP_000076690.1.33520 WP_000076690.1.33538 WP_000076690.1.33575 WP_000076690.1.33594 WP_000076690.1.33607 WP_000076690.1.33610 WP_000076690.1.33626 WP_000076690.1.33627 WP_000076690.1.3363 WP_000076690.1.33650 WP_000076690.1.33654 WP_000076690.1.33655 WP_000076690.1.33692 WP_000076690.1.33695 WP_000076690.1.33707 WP_000076690.1.33718 WP_000076690.1.33724 WP_000076690.1.33735 WP_000076690.1.33737 WP_000076690.1.33743 WP_000076690.1.33756 WP_000076690.1.33766 WP_000076690.1.33767 WP_000076690.1.33769 WP_000076690.1.33778 WP_000076690.1.33792 WP_000076690.1.33804 WP_000076690.1.33813 WP_000076690.1.33899 WP_000076690.1.33949 WP_000076690.1.33963 WP_000076690.1.33968 WP_000076690.1.33971 WP_000076690.1.33983 WP_000076690.1.33989 WP_000076690.1.33994 WP_000076690.1.34026 WP_000076690.1.34030 WP_000076690.1.34051 WP_000076690.1.34060 WP_000076690.1.34062 WP_000076690.1.34069 WP_000076690.1.34078 WP_000076690.1.34089 WP_000076690.1.34100 WP_000076690.1.34105 WP_000076690.1.34112 WP_000076690.1.34132 WP_000076690.1.34168 WP_000076690.1.3418 WP_000076690.1.34182 WP_000076690.1.34194 WP_000076690.1.34209 WP_000076690.1.34244 WP_000076690.1.34250 WP_000076690.1.34251 WP_000076690.1.34254 WP_000076690.1.34285 WP_000076690.1.34361 WP_000076690.1.34371 WP_000076690.1.34381 WP_000076690.1.34403 WP_000076690.1.34410 WP_000076690.1.3442 WP_000076690.1.34471 WP_000076690.1.34473 WP_000076690.1.34482 WP_000076690.1.34492 WP_000076690.1.34502 WP_000076690.1.34510 WP_000076690.1.34526 WP_000076690.1.34531 WP_000076690.1.34569 WP_000076690.1.3461 WP_000076690.1.34677 WP_000076690.1.34716 WP_000076690.1.34723 WP_000076690.1.34733 WP_000076690.1.34737 WP_000076690.1.3474 WP_000076690.1.34741 WP_000076690.1.34767 WP_000076690.1.34774 WP_000076690.1.34818 WP_000076690.1.34847 WP_000076690.1.34865 WP_000076690.1.34890 WP_000076690.1.34912 WP_000076690.1.34918 WP_000076690.1.34923 WP_000076690.1.34926 WP_000076690.1.34943 WP_000076690.1.34967 WP_000076690.1.34970 WP_000076690.1.34998 WP_000076690.1.35014 WP_000076690.1.35029 WP_000076690.1.35031 WP_000076690.1.35032 WP_000076690.1.35054 WP_000076690.1.35059 WP_000076690.1.35062 WP_000076690.1.35089 WP_000076690.1.35097 WP_000076690.1.35110 WP_000076690.1.35121 WP_000076690.1.35182 WP_000076690.1.35183 WP_000076690.1.35194 WP_000076690.1.35233 WP_000076690.1.35243 WP_000076690.1.35276 WP_000076690.1.35285 WP_000076690.1.35289 WP_000076690.1.35297 WP_000076690.1.35314 WP_000076690.1.35334 WP_000076690.1.35340 WP_000076690.1.35342 WP_000076690.1.35391 WP_000076690.1.354 WP_000076690.1.35413 WP_000076690.1.35415 WP_000076690.1.35423 WP_000076690.1.35433 WP_000076690.1.35435 WP_000076690.1.3547 WP_000076690.1.3549 WP_000076690.1.35498 WP_000076690.1.35506 WP_000076690.1.35508 WP_000076690.1.35517 WP_000076690.1.35519 WP_000076690.1.35525 WP_000076690.1.35549 WP_000076690.1.35580 WP_000076690.1.35615 WP_000076690.1.35623 WP_000076690.1.35642 WP_000076690.1.35661 WP_000076690.1.35673 WP_000076690.1.35686 WP_000076690.1.3569 WP_000076690.1.35696 WP_000076690.1.35742 WP_000076690.1.35746 WP_000076690.1.35784 WP_000076690.1.3579 WP_000076690.1.35801 WP_000076690.1.35826 WP_000076690.1.35837 WP_000076690.1.35890 WP_000076690.1.35900 WP_000076690.1.35903 WP_000076690.1.35928 WP_000076690.1.35950 WP_000076690.1.35958 WP_000076690.1.36004 WP_000076690.1.36082 WP_000076690.1.36093 WP_000076690.1.36102 WP_000076690.1.3611 WP_000076690.1.36119 WP_000076690.1.36141 WP_000076690.1.3617 WP_000076690.1.36176 WP_000076690.1.36179 WP_000076690.1.36187 WP_000076690.1.36188 WP_000076690.1.36208 WP_000076690.1.36211 WP_000076690.1.36223 WP_000076690.1.36231 WP_000076690.1.36249 WP_000076690.1.36250 WP_000076690.1.36264 WP_000076690.1.36278 WP_000076690.1.36282 WP_000076690.1.36302 WP_000076690.1.36307 WP_000076690.1.36344 WP_000076690.1.36389 WP_000076690.1.36430 WP_000076690.1.36434 WP_000076690.1.36439 WP_000076690.1.36532 WP_000076690.1.36535 WP_000076690.1.3655 WP_000076690.1.36570 WP_000076690.1.36580 WP_000076690.1.36600 WP_000076690.1.36615 WP_000076690.1.36640 WP_000076690.1.36646 WP_000076690.1.3666 WP_000076690.1.36689 WP_000076690.1.36697 WP_000076690.1.36698 WP_000076690.1.36704 WP_000076690.1.36729 WP_000076690.1.36745 WP_000076690.1.3675 WP_000076690.1.36773 WP_000076690.1.36783 WP_000076690.1.36797 WP_000076690.1.36822 WP_000076690.1.36847 WP_000076690.1.3685 WP_000076690.1.36858 WP_000076690.1.3687 WP_000076690.1.36888 WP_000076690.1.3690 WP_000076690.1.36903 WP_000076690.1.36911 WP_000076690.1.36916 WP_000076690.1.36955 WP_000076690.1.36962 WP_000076690.1.36979 WP_000076690.1.36980 WP_000076690.1.36983 WP_000076690.1.36997 WP_000076690.1.37002 WP_000076690.1.37016 WP_000076690.1.3703 WP_000076690.1.37044 WP_000076690.1.37045 WP_000076690.1.37053 WP_000076690.1.37055 WP_000076690.1.3709 WP_000076690.1.37120 WP_000076690.1.37121 WP_000076690.1.37130 WP_000076690.1.37134 WP_000076690.1.37135 WP_000076690.1.37145 WP_000076690.1.37159 WP_000076690.1.3718 WP_000076690.1.3719 WP_000076690.1.3722 WP_000076690.1.37220 WP_000076690.1.37240 WP_000076690.1.37335 WP_000076690.1.37378 WP_000076690.1.37398 WP_000076690.1.37408 WP_000076690.1.37411 WP_000076690.1.37424 WP_000076690.1.37435 WP_000076690.1.37453 WP_000076690.1.37467 WP_000076690.1.37503 WP_000076690.1.37525 WP_000076690.1.37546 WP_000076690.1.37578 WP_000076690.1.37583 WP_000076690.1.37602 WP_000076690.1.37605 WP_000076690.1.37621 WP_000076690.1.37624 WP_000076690.1.37644 WP_000076690.1.37669 WP_000076690.1.37679 WP_000076690.1.3774 WP_000076690.1.37749 WP_000076690.1.37764 WP_000076690.1.37771 WP_000076690.1.37781 WP_000076690.1.37788 WP_000076690.1.37815 WP_000076690.1.37828 WP_000076690.1.37851 WP_000076690.1.37855 WP_000076690.1.37866 WP_000076690.1.37875 WP_000076690.1.37878 WP_000076690.1.37891 WP_000076690.1.37906 WP_000076690.1.37907 WP_000076690.1.37929 WP_000076690.1.37953 WP_000076690.1.37987 WP_000076690.1.38020 WP_000076690.1.38030 WP_000076690.1.38034 WP_000076690.1.38038 WP_000076690.1.38057 WP_000076690.1.38070 WP_000076690.1.38082 WP_000076690.1.3809 WP_000076690.1.38100 WP_000076690.1.38111 WP_000076690.1.38128 WP_000076690.1.3813 WP_000076690.1.38136 WP_000076690.1.38148 WP_000076690.1.38160 WP_000076690.1.3817 WP_000076690.1.38177 WP_000076690.1.3820 WP_000076690.1.38212 WP_000076690.1.38222 WP_000076690.1.38229 WP_000076690.1.38230 WP_000076690.1.38232 WP_000076690.1.38276 WP_000076690.1.38282 WP_000076690.1.38304 WP_000076690.1.38309 WP_000076690.1.38339 WP_000076690.1.38383 WP_000076690.1.3842 WP_000076690.1.38437 WP_000076690.1.38453 WP_000076690.1.38493 WP_000076690.1.38516 WP_000076690.1.3852 WP_000076690.1.38522 WP_000076690.1.38546 WP_000076690.1.38555 WP_000076690.1.38557 WP_000076690.1.38607 WP_000076690.1.38612 WP_000076690.1.38637 WP_000076690.1.3867 WP_000076690.1.38674 WP_000076690.1.38688 WP_000076690.1.38721 WP_000076690.1.3875 WP_000076690.1.38760 WP_000076690.1.38823 WP_000076690.1.38836 WP_000076690.1.38841 WP_000076690.1.38858 WP_000076690.1.38875 WP_000076690.1.38885 WP_000076690.1.38890 WP_000076690.1.38926 WP_000076690.1.38927 WP_000076690.1.38931 WP_000076690.1.38940 WP_000076690.1.38941 WP_000076690.1.38972 WP_000076690.1.38973 WP_000076690.1.38985 WP_000076690.1.38989 WP_000076690.1.390 WP_000076690.1.39012 WP_000076690.1.39014 WP_000076690.1.39017 WP_000076690.1.39026 WP_000076690.1.39043 WP_000076690.1.39053 WP_000076690.1.3906 WP_000076690.1.3908 WP_000076690.1.391 WP_000076690.1.39108 WP_000076690.1.39126 WP_000076690.1.39166 WP_000076690.1.39203 WP_000076690.1.39206 WP_000076690.1.39217 WP_000076690.1.39241 WP_000076690.1.3926 WP_000076690.1.39272 WP_000076690.1.39285 WP_000076690.1.39290 WP_000076690.1.39330 WP_000076690.1.39332 WP_000076690.1.39333 WP_000076690.1.39361 WP_000076690.1.39378 WP_000076690.1.39397 WP_000076690.1.39406 WP_000076690.1.39432 WP_000076690.1.39486 WP_000076690.1.39499 WP_000076690.1.39506 WP_000076690.1.39519 WP_000076690.1.39542 WP_000076690.1.39550 WP_000076690.1.39645 WP_000076690.1.39670 WP_000076690.1.39671 WP_000076690.1.39682 WP_000076690.1.39687 WP_000076690.1.39689 WP_000076690.1.39693 WP_000076690.1.39697 WP_000076690.1.39738 WP_000076690.1.39767 WP_000076690.1.39789 WP_000076690.1.39832 WP_000076690.1.39838 WP_000076690.1.39839 WP_000076690.1.39856 WP_000076690.1.39857 WP_000076690.1.39869 WP_000076690.1.39918 WP_000076690.1.39943 WP_000076690.1.39995 WP_000076690.1.40014 WP_000076690.1.40043 WP_000076690.1.40076 WP_000076690.1.40099 WP_000076690.1.4010 WP_000076690.1.40120 WP_000076690.1.40149 WP_000076690.1.4015 WP_000076690.1.40161 WP_000076690.1.40164 WP_000076690.1.40173 WP_000076690.1.4019 WP_000076690.1.40247 WP_000076690.1.40299 WP_000076690.1.40318 WP_000076690.1.40320 WP_000076690.1.40329 WP_000076690.1.40330 WP_000076690.1.40340 WP_000076690.1.40342 WP_000076690.1.40368 WP_000076690.1.40369 WP_000076690.1.40428 WP_000076690.1.4045 WP_000076690.1.40472 WP_000076690.1.40474 WP_000076690.1.40481 WP_000076690.1.40483 WP_000076690.1.40500 WP_000076690.1.40505 WP_000076690.1.40531 WP_000076690.1.40532 WP_000076690.1.40554 WP_000076690.1.4056 WP_000076690.1.4057 WP_000076690.1.40579 WP_000076690.1.40588 WP_000076690.1.40613 WP_000076690.1.40620 WP_000076690.1.40644 WP_000076690.1.40655 WP_000076690.1.40658 WP_000076690.1.40670 WP_000076690.1.40700 WP_000076690.1.40719 WP_000076690.1.40729 WP_000076690.1.40748 WP_000076690.1.40760 WP_000076690.1.40780 WP_000076690.1.40794 WP_000076690.1.40814 WP_000076690.1.40816 WP_000076690.1.40939 WP_000076690.1.40997 WP_000076690.1.41002 WP_000076690.1.41033 WP_000076690.1.41038 WP_000076690.1.4105 WP_000076690.1.41058 WP_000076690.1.41064 WP_000076690.1.41066 WP_000076690.1.41094 WP_000076690.1.41104 WP_000076690.1.41119 WP_000076690.1.41122 WP_000076690.1.41129 WP_000076690.1.41133 WP_000076690.1.4115 WP_000076690.1.41178 WP_000076690.1.41208 WP_000076690.1.41241 WP_000076690.1.41255 WP_000076690.1.41289 WP_000076690.1.4129 WP_000076690.1.41350 WP_000076690.1.41374 WP_000076690.1.41386 WP_000076690.1.41389 WP_000076690.1.41411 WP_000076690.1.41426 WP_000076690.1.41432 WP_000076690.1.41433 WP_000076690.1.4144 WP_000076690.1.41448 WP_000076690.1.41499 WP_000076690.1.41532 WP_000076690.1.41533 WP_000076690.1.41537 WP_000076690.1.41555 WP_000076690.1.41558 WP_000076690.1.41567 WP_000076690.1.41581 WP_000076690.1.41582 WP_000076690.1.41587 WP_000076690.1.41598 WP_000076690.1.41612 WP_000076690.1.41620 WP_000076690.1.41674 WP_000076690.1.41681 WP_000076690.1.4169 WP_000076690.1.41726 WP_000076690.1.41755 WP_000076690.1.41770 WP_000076690.1.41796 WP_000076690.1.4182 WP_000076690.1.41839 WP_000076690.1.41863 WP_000076690.1.4188 WP_000076690.1.41891 WP_000076690.1.41898 WP_000076690.1.41935 WP_000076690.1.41943 WP_000076690.1.41972 WP_000076690.1.41989 WP_000076690.1.420 WP_000076690.1.42003 WP_000076690.1.42015 WP_000076690.1.42017 WP_000076690.1.42028 WP_000076690.1.42056 WP_000076690.1.42072 WP_000076690.1.42085 WP_000076690.1.42087 WP_000076690.1.42125 WP_000076690.1.42137 WP_000076690.1.42169 WP_000076690.1.42178 WP_000076690.1.42241 WP_000076690.1.4225 WP_000076690.1.42269 WP_000076690.1.42298 WP_000076690.1.42325 WP_000076690.1.42344 WP_000076690.1.42355 WP_000076690.1.42403 WP_000076690.1.42436 WP_000076690.1.42459 WP_000076690.1.42460 WP_000076690.1.42481 WP_000076690.1.42510 WP_000076690.1.42551 WP_000076690.1.42575 WP_000076690.1.42593 WP_000076690.1.426 WP_000076690.1.42607 WP_000076690.1.42640 WP_000076690.1.42652 WP_000076690.1.42667 WP_000076690.1.42668 WP_000076690.1.42674 WP_000076690.1.42681 WP_000076690.1.42733 WP_000076690.1.42737 WP_000076690.1.42738 WP_000076690.1.42740 WP_000076690.1.42759 WP_000076690.1.42764 WP_000076690.1.42788 WP_000076690.1.42798 WP_000076690.1.42816 WP_000076690.1.42819 WP_000076690.1.42907 WP_000076690.1.42925 WP_000076690.1.4293 WP_000076690.1.42959 WP_000076690.1.42984 WP_000076690.1.4299 WP_000076690.1.42990 WP_000076690.1.4300 WP_000076690.1.43014 WP_000076690.1.43023 WP_000076690.1.43047 WP_000076690.1.43061 WP_000076690.1.43072 WP_000076690.1.43095 WP_000076690.1.43110 WP_000076690.1.43114 WP_000076690.1.43122 WP_000076690.1.43125 WP_000076690.1.43131 WP_000076690.1.43134 WP_000076690.1.43139 WP_000076690.1.43143 WP_000076690.1.43147 WP_000076690.1.43159 WP_000076690.1.43165 WP_000076690.1.43168 WP_000076690.1.43179 WP_000076690.1.43200 WP_000076690.1.43202 WP_000076690.1.43204 WP_000076690.1.43206 WP_000076690.1.43232 WP_000076690.1.4325 WP_000076690.1.43252 WP_000076690.1.43263 WP_000076690.1.4327 WP_000076690.1.43274 WP_000076690.1.43279 WP_000076690.1.43323 WP_000076690.1.43331 WP_000076690.1.43341 WP_000076690.1.43349 WP_000076690.1.43360 WP_000076690.1.43369 WP_000076690.1.4337 WP_000076690.1.43375 WP_000076690.1.43383 WP_000076690.1.43405 WP_000076690.1.43406 WP_000076690.1.4341 WP_000076690.1.43446 WP_000076690.1.43460 WP_000076690.1.4347 WP_000076690.1.43506 WP_000076690.1.43512 WP_000076690.1.43550 WP_000076690.1.43560 WP_000076690.1.43573 WP_000076690.1.43617 WP_000076690.1.43627 WP_000076690.1.43659 WP_000076690.1.43665 WP_000076690.1.43670 WP_000076690.1.43683 WP_000076690.1.43702 WP_000076690.1.4372 WP_000076690.1.43731 WP_000076690.1.43752 WP_000076690.1.43784 WP_000076690.1.43800 WP_000076690.1.43819 WP_000076690.1.43827 WP_000076690.1.4385 WP_000076690.1.43851 WP_000076690.1.4386 WP_000076690.1.43904 WP_000076690.1.43915 WP_000076690.1.43988 WP_000076690.1.43995 WP_000076690.1.44074 WP_000076690.1.44119 WP_000076690.1.44153 WP_000076690.1.44177 WP_000076690.1.44181 WP_000076690.1.44186 WP_000076690.1.44195 WP_000076690.1.44265 WP_000076690.1.44302 WP_000076690.1.44344 WP_000076690.1.44382 WP_000076690.1.44388 WP_000076690.1.44396 WP_000076690.1.44405 WP_000076690.1.44420 WP_000076690.1.44432 WP_000076690.1.44504 WP_000076690.1.44515 WP_000076690.1.44520 WP_000076690.1.44536 WP_000076690.1.44544 WP_000076690.1.44547 WP_000076690.1.44579 WP_000076690.1.44586 WP_000076690.1.44588 WP_000076690.1.44605 WP_000076690.1.44623 WP_000076690.1.44631 WP_000076690.1.44655 WP_000076690.1.44667 WP_000076690.1.44672 WP_000076690.1.447 WP_000076690.1.44714 WP_000076690.1.44715 WP_000076690.1.44732 WP_000076690.1.44755 WP_000076690.1.44785 WP_000076690.1.44788 WP_000076690.1.44796 WP_000076690.1.44856 WP_000076690.1.44868 WP_000076690.1.44876 WP_000076690.1.44881 WP_000076690.1.44882 WP_000076690.1.44892 WP_000076690.1.44903 WP_000076690.1.44914 WP_000076690.1.44940 WP_000076690.1.44955 WP_000076690.1.44969 WP_000076690.1.4499 WP_000076690.1.44993 WP_000076690.1.45008 WP_000076690.1.45010 WP_000076690.1.45033 WP_000076690.1.45035 WP_000076690.1.45042 WP_000076690.1.45080 WP_000076690.1.45091 WP_000076690.1.45094 WP_000076690.1.45099 WP_000076690.1.45101 WP_000076690.1.4513 WP_000076690.1.45131 WP_000076690.1.45132 WP_000076690.1.45133 WP_000076690.1.45140 WP_000076690.1.45157 WP_000076690.1.45162 WP_000076690.1.45164 WP_000076690.1.45170 WP_000076690.1.45218 WP_000076690.1.45223 WP_000076690.1.45242 WP_000076690.1.45267 WP_000076690.1.4527 WP_000076690.1.45272 WP_000076690.1.45281 WP_000076690.1.45290 WP_000076690.1.45297 WP_000076690.1.453 WP_000076690.1.45364 WP_000076690.1.45431 WP_000076690.1.45439 WP_000076690.1.4545 WP_000076690.1.45450 WP_000076690.1.45456 WP_000076690.1.45472 WP_000076690.1.45492 WP_000076690.1.4550 WP_000076690.1.45507 WP_000076690.1.45542 WP_000076690.1.45555 WP_000076690.1.45560 WP_000076690.1.45574 WP_000076690.1.45577 WP_000076690.1.45610 WP_000076690.1.45620 WP_000076690.1.45645 WP_000076690.1.45654 WP_000076690.1.45670 WP_000076690.1.45703 WP_000076690.1.45705 WP_000076690.1.45730 WP_000076690.1.45763 WP_000076690.1.45768 WP_000076690.1.4577 WP_000076690.1.45771 WP_000076690.1.45773 WP_000076690.1.45780 WP_000076690.1.4582 WP_000076690.1.45822 WP_000076690.1.4584 WP_000076690.1.45852 WP_000076690.1.45859 WP_000076690.1.45862 WP_000076690.1.45874 WP_000076690.1.45878 WP_000076690.1.45897 WP_000076690.1.45954 WP_000076690.1.4597 WP_000076690.1.45972 WP_000076690.1.45977 WP_000076690.1.45979 WP_000076690.1.4598 WP_000076690.1.46003 WP_000076690.1.46005 WP_000076690.1.46035 WP_000076690.1.46037 WP_000076690.1.46050 WP_000076690.1.46055 WP_000076690.1.46062 WP_000076690.1.46078 WP_000076690.1.46082 WP_000076690.1.46087 WP_000076690.1.46109 WP_000076690.1.46168 WP_000076690.1.46171 WP_000076690.1.46172 WP_000076690.1.46185 WP_000076690.1.46208 WP_000076690.1.46222 WP_000076690.1.46228 WP_000076690.1.46248 WP_000076690.1.46276 WP_000076690.1.46330 WP_000076690.1.46333 WP_000076690.1.46334 WP_000076690.1.46339 WP_000076690.1.46353 WP_000076690.1.46362 WP_000076690.1.46368 WP_000076690.1.46380 WP_000076690.1.46389 WP_000076690.1.46401 WP_000076690.1.46418 WP_000076690.1.46422 WP_000076690.1.46465 WP_000076690.1.46529 WP_000076690.1.46543 WP_000076690.1.46608 WP_000076690.1.46619 WP_000076690.1.4662 WP_000076690.1.46648 WP_000076690.1.46660 WP_000076690.1.46664 WP_000076690.1.46670 WP_000076690.1.46692 WP_000076690.1.46702 WP_000076690.1.46703 WP_000076690.1.46720 WP_000076690.1.46736 WP_000076690.1.46752 WP_000076690.1.46765 WP_000076690.1.46770 WP_000076690.1.4680 WP_000076690.1.46852 WP_000076690.1.46881 WP_000076690.1.46906 WP_000076690.1.46908 WP_000076690.1.46911 WP_000076690.1.46914 WP_000076690.1.46925 WP_000076690.1.46929 WP_000076690.1.46937 WP_000076690.1.4694 WP_000076690.1.46947 WP_000076690.1.46983 WP_000076690.1.46995 WP_000076690.1.47002 WP_000076690.1.47051 WP_000076690.1.47090 WP_000076690.1.47107 WP_000076690.1.47111 WP_000076690.1.47128 WP_000076690.1.47153 WP_000076690.1.47159 WP_000076690.1.47163 WP_000076690.1.47187 WP_000076690.1.47211 WP_000076690.1.47216 WP_000076690.1.47250 WP_000076690.1.47258 WP_000076690.1.47269 WP_000076690.1.47279 WP_000076690.1.4728 WP_000076690.1.47282 WP_000076690.1.47290 WP_000076690.1.47294 WP_000076690.1.47306 WP_000076690.1.47328 WP_000076690.1.47334 WP_000076690.1.47353 WP_000076690.1.47381 WP_000076690.1.47399 WP_000076690.1.47406 WP_000076690.1.47432 WP_000076690.1.47439 WP_000076690.1.47459 WP_000076690.1.47522 WP_000076690.1.47560 WP_000076690.1.47561 WP_000076690.1.47617 WP_000076690.1.47618 WP_000076690.1.47669 WP_000076690.1.4767 WP_000076690.1.47680 WP_000076690.1.47719 WP_000076690.1.47733 WP_000076690.1.47747 WP_000076690.1.47763 WP_000076690.1.47782 WP_000076690.1.47836 WP_000076690.1.47851 WP_000076690.1.47859 WP_000076690.1.47872 WP_000076690.1.47873 WP_000076690.1.47888 WP_000076690.1.47904 WP_000076690.1.47908 WP_000076690.1.4792 WP_000076690.1.47996 WP_000076690.1.48011 WP_000076690.1.48013 WP_000076690.1.48030 WP_000076690.1.48046 WP_000076690.1.48047 WP_000076690.1.4805 WP_000076690.1.48064 WP_000076690.1.48067 WP_000076690.1.48116 WP_000076690.1.48142 WP_000076690.1.48149 WP_000076690.1.4815 WP_000076690.1.48154 WP_000076690.1.48169 WP_000076690.1.48186 WP_000076690.1.48187 WP_000076690.1.48199 WP_000076690.1.48205 WP_000076690.1.48212 WP_000076690.1.48223 WP_000076690.1.48227 WP_000076690.1.48236 WP_000076690.1.48250 WP_000076690.1.48272 WP_000076690.1.48282 WP_000076690.1.48284 WP_000076690.1.48293 WP_000076690.1.48307 WP_000076690.1.48310 WP_000076690.1.48322 WP_000076690.1.48338 WP_000076690.1.48376 WP_000076690.1.48391 WP_000076690.1.48394 WP_000076690.1.48398 WP_000076690.1.4840 WP_000076690.1.48427 WP_000076690.1.48437 WP_000076690.1.48438 WP_000076690.1.48463 WP_000076690.1.48479 WP_000076690.1.4852 WP_000076690.1.48556 WP_000076690.1.48563 WP_000076690.1.48577 WP_000076690.1.48580 WP_000076690.1.48593 WP_000076690.1.48601 WP_000076690.1.48634 WP_000076690.1.48655 WP_000076690.1.48656 WP_000076690.1.48664 WP_000076690.1.48670 WP_000076690.1.4868 WP_000076690.1.48705 WP_000076690.1.48711 WP_000076690.1.48723 WP_000076690.1.48769 WP_000076690.1.48775 WP_000076690.1.48782 WP_000076690.1.48805 WP_000076690.1.48818 WP_000076690.1.48823 WP_000076690.1.48833 WP_000076690.1.48835 WP_000076690.1.4886 WP_000076690.1.48869 WP_000076690.1.48936 WP_000076690.1.48941 WP_000076690.1.48945 WP_000076690.1.48951 WP_000076690.1.48966 WP_000076690.1.48968 WP_000076690.1.48982 WP_000076690.1.48993 WP_000076690.1.4901 WP_000076690.1.49018 WP_000076690.1.4905 WP_000076690.1.49071 WP_000076690.1.49094 WP_000076690.1.49105 WP_000076690.1.49129 WP_000076690.1.49143 WP_000076690.1.49154 WP_000076690.1.49159 WP_000076690.1.4916 WP_000076690.1.49161 WP_000076690.1.4917 WP_000076690.1.49171 WP_000076690.1.49173 WP_000076690.1.4918 WP_000076690.1.49189 WP_000076690.1.49196 WP_000076690.1.49199 WP_000076690.1.49207 WP_000076690.1.49248 WP_000076690.1.49257 WP_000076690.1.49301 WP_000076690.1.49326 WP_000076690.1.49327 WP_000076690.1.49330 WP_000076690.1.49367 WP_000076690.1.49373 WP_000076690.1.49398 WP_000076690.1.49418 WP_000076690.1.4945 WP_000076690.1.4950 WP_000076690.1.49518 WP_000076690.1.49549 WP_000076690.1.49581 WP_000076690.1.49582 WP_000076690.1.496 WP_000076690.1.49603 WP_000076690.1.4962 WP_000076690.1.49643 WP_000076690.1.49653 WP_000076690.1.49669 WP_000076690.1.49672 WP_000076690.1.49690 WP_000076690.1.49728 WP_000076690.1.49730 WP_000076690.1.49732 WP_000076690.1.49742 WP_000076690.1.4980 WP_000076690.1.49800 WP_000076690.1.49819 WP_000076690.1.4984 WP_000076690.1.49860 WP_000076690.1.49863 WP_000076690.1.49871 WP_000076690.1.4989 WP_000076690.1.49894 WP_000076690.1.49907 WP_000076690.1.49912 WP_000076690.1.49913 WP_000076690.1.49918 WP_000076690.1.49921 WP_000076690.1.49934 WP_000076690.1.49935 WP_000076690.1.49936 WP_000076690.1.4994 WP_000076690.1.49970 WP_000076690.1.49982 WP_000076690.1.50013 WP_000076690.1.50015 WP_000076690.1.50028 WP_000076690.1.50038 WP_000076690.1.50039 WP_000076690.1.50061 WP_000076690.1.50076 WP_000076690.1.50117 WP_000076690.1.5013 WP_000076690.1.50138 WP_000076690.1.50145 WP_000076690.1.50178 WP_000076690.1.50192 WP_000076690.1.50217 WP_000076690.1.50219 WP_000076690.1.50229 WP_000076690.1.50261 WP_000076690.1.50291 WP_000076690.1.50313 WP_000076690.1.50314 WP_000076690.1.50356 WP_000076690.1.50360 WP_000076690.1.50367 WP_000076690.1.50377 WP_000076690.1.50388 WP_000076690.1.50425 WP_000076690.1.50430 WP_000076690.1.50431 WP_000076690.1.5045 WP_000076690.1.50464 WP_000076690.1.50516 WP_000076690.1.50525 WP_000076690.1.50536 WP_000076690.1.50555 WP_000076690.1.50558 WP_000076690.1.50568 WP_000076690.1.50578 WP_000076690.1.5059 WP_000076690.1.50594 WP_000076690.1.50595 WP_000076690.1.50647 WP_000076690.1.50660 WP_000076690.1.50669 WP_000076690.1.50699 WP_000076690.1.50740 WP_000076690.1.50759 WP_000076690.1.50768 WP_000076690.1.50799 WP_000076690.1.50817 WP_000076690.1.50820 WP_000076690.1.50827 WP_000076690.1.50829 WP_000076690.1.50896 WP_000076690.1.50937 WP_000076690.1.50962 WP_000076690.1.50974 WP_000076690.1.51008 WP_000076690.1.51015 WP_000076690.1.5108 WP_000076690.1.51085 WP_000076690.1.5109 WP_000076690.1.5110 WP_000076690.1.5111 WP_000076690.1.51130 WP_000076690.1.51138 WP_000076690.1.51152 WP_000076690.1.51209 WP_000076690.1.51220 WP_000076690.1.51226 WP_000076690.1.51236 WP_000076690.1.51245 WP_000076690.1.51250 WP_000076690.1.51271 WP_000076690.1.51277 WP_000076690.1.51282 WP_000076690.1.51295 WP_000076690.1.51306 WP_000076690.1.51310 WP_000076690.1.51326 WP_000076690.1.51346 WP_000076690.1.51376 WP_000076690.1.51393 WP_000076690.1.51403 WP_000076690.1.51454 WP_000076690.1.51456 WP_000076690.1.51465 WP_000076690.1.51492 WP_000076690.1.51496 WP_000076690.1.515 WP_000076690.1.51527 WP_000076690.1.5155 WP_000076690.1.51557 WP_000076690.1.51559 WP_000076690.1.51571 WP_000076690.1.51575 WP_000076690.1.51590 WP_000076690.1.51665 WP_000076690.1.51672 WP_000076690.1.51716 WP_000076690.1.51741 WP_000076690.1.51748 WP_000076690.1.51787 WP_000076690.1.51812 WP_000076690.1.51824 WP_000076690.1.51836 WP_000076690.1.51842 WP_000076690.1.51844 WP_000076690.1.51871 WP_000076690.1.51883 WP_000076690.1.5190 WP_000076690.1.51920 WP_000076690.1.51924 WP_000076690.1.51936 WP_000076690.1.51952 WP_000076690.1.51971 WP_000076690.1.51995 WP_000076690.1.52034 WP_000076690.1.52061 WP_000076690.1.52072 WP_000076690.1.52078 WP_000076690.1.5209 WP_000076690.1.521 WP_000076690.1.5213 WP_000076690.1.52151 WP_000076690.1.52162 WP_000076690.1.52182 WP_000076690.1.52185 WP_000076690.1.52193 WP_000076690.1.52195 WP_000076690.1.52198 WP_000076690.1.52210 WP_000076690.1.52224 WP_000076690.1.52251 WP_000076690.1.52252 WP_000076690.1.52259 WP_000076690.1.52289 WP_000076690.1.52296 WP_000076690.1.523 WP_000076690.1.52308 WP_000076690.1.52322 WP_000076690.1.52327 WP_000076690.1.52331 WP_000076690.1.52340 WP_000076690.1.52343 WP_000076690.1.52377 WP_000076690.1.52396 WP_000076690.1.52423 WP_000076690.1.52427 WP_000076690.1.52436 WP_000076690.1.52440 WP_000076690.1.52442 WP_000076690.1.52452 WP_000076690.1.52463 WP_000076690.1.5251 WP_000076690.1.52511 WP_000076690.1.52518 WP_000076690.1.52536 WP_000076690.1.52548 WP_000076690.1.52595 WP_000076690.1.52605 WP_000076690.1.52623 WP_000076690.1.52624 WP_000076690.1.52645 WP_000076690.1.52687 WP_000076690.1.52699 WP_000076690.1.52715 WP_000076690.1.52722 WP_000076690.1.52751 WP_000076690.1.52772 WP_000076690.1.52820 WP_000076690.1.52830 WP_000076690.1.52838 WP_000076690.1.52848 WP_000076690.1.52877 WP_000076690.1.52878 WP_000076690.1.52886 WP_000076690.1.52889 WP_000076690.1.52900 WP_000076690.1.52904 WP_000076690.1.52941 WP_000076690.1.52947 WP_000076690.1.52965 WP_000076690.1.52983 WP_000076690.1.52984 WP_000076690.1.53002 WP_000076690.1.5304 WP_000076690.1.53050 WP_000076690.1.53057 WP_000076690.1.53071 WP_000076690.1.53077 WP_000076690.1.53140 WP_000076690.1.53153 WP_000076690.1.53178 WP_000076690.1.53209 WP_000076690.1.5321 WP_000076690.1.5323 WP_000076690.1.53245 WP_000076690.1.53260 WP_000076690.1.53285 WP_000076690.1.53312 WP_000076690.1.53317 WP_000076690.1.53319 WP_000076690.1.53352 WP_000076690.1.53363 WP_000076690.1.53373 WP_000076690.1.53379 WP_000076690.1.53387 WP_000076690.1.53394 WP_000076690.1.53403 WP_000076690.1.53408 WP_000076690.1.53432 WP_000076690.1.53433 WP_000076690.1.53452 WP_000076690.1.53462 WP_000076690.1.53467 WP_000076690.1.5347 WP_000076690.1.53503 WP_000076690.1.53521 WP_000076690.1.53532 WP_000076690.1.53577 WP_000076690.1.53641 WP_000076690.1.53648 WP_000076690.1.53661 WP_000076690.1.53671 WP_000076690.1.53682 WP_000076690.1.53712 WP_000076690.1.53714 WP_000076690.1.53763 WP_000076690.1.53766 WP_000076690.1.53774 WP_000076690.1.53786 WP_000076690.1.53799 WP_000076690.1.53827 WP_000076690.1.53835 WP_000076690.1.53889 WP_000076690.1.53911 WP_000076690.1.53915 WP_000076690.1.53926 WP_000076690.1.53934 WP_000076690.1.53969 WP_000076690.1.53999 WP_000076690.1.5401 WP_000076690.1.54022 WP_000076690.1.54049 WP_000076690.1.54074 WP_000076690.1.54086 WP_000076690.1.54109 WP_000076690.1.54135 WP_000076690.1.54147 WP_000076690.1.54161 WP_000076690.1.54229 WP_000076690.1.54237 WP_000076690.1.54253 WP_000076690.1.54269 WP_000076690.1.54297 WP_000076690.1.54299 WP_000076690.1.54395 WP_000076690.1.544 WP_000076690.1.54404 WP_000076690.1.54413 WP_000076690.1.54438 WP_000076690.1.54471 WP_000076690.1.54477 WP_000076690.1.54479 WP_000076690.1.54485 WP_000076690.1.54503 WP_000076690.1.54510 WP_000076690.1.54551 WP_000076690.1.54554 WP_000076690.1.54574 WP_000076690.1.54637 WP_000076690.1.54675 WP_000076690.1.54689 WP_000076690.1.5469 WP_000076690.1.54744 WP_000076690.1.54745 WP_000076690.1.54753 WP_000076690.1.54830 WP_000076690.1.54851 WP_000076690.1.54878 WP_000076690.1.54914 WP_000076690.1.54931 WP_000076690.1.54955 WP_000076690.1.54967 WP_000076690.1.54990 WP_000076690.1.5500 WP_000076690.1.55004 WP_000076690.1.55014 WP_000076690.1.55082 WP_000076690.1.55084 WP_000076690.1.55095 WP_000076690.1.55100 WP_000076690.1.5518 WP_000076690.1.5519 WP_000076690.1.552 WP_000076690.1.55214 WP_000076690.1.55239 WP_000076690.1.55271 WP_000076690.1.55274 WP_000076690.1.55309 WP_000076690.1.55327 WP_000076690.1.55336 WP_000076690.1.5536 WP_000076690.1.55367 WP_000076690.1.55369 WP_000076690.1.55403 WP_000076690.1.55405 WP_000076690.1.55419 WP_000076690.1.55421 WP_000076690.1.55495 WP_000076690.1.5550 WP_000076690.1.55508 WP_000076690.1.55527 WP_000076690.1.55535 WP_000076690.1.5554 WP_000076690.1.55544 WP_000076690.1.55558 WP_000076690.1.5556 WP_000076690.1.55583 WP_000076690.1.5559 WP_000076690.1.55603 WP_000076690.1.55628 WP_000076690.1.55637 WP_000076690.1.5565 WP_000076690.1.55653 WP_000076690.1.55657 WP_000076690.1.557 WP_000076690.1.55719 WP_000076690.1.55724 WP_000076690.1.55728 WP_000076690.1.5575 WP_000076690.1.55784 WP_000076690.1.55786 WP_000076690.1.5580 WP_000076690.1.55818 WP_000076690.1.55831 WP_000076690.1.55835 WP_000076690.1.55839 WP_000076690.1.55845 WP_000076690.1.55848 WP_000076690.1.55867 WP_000076690.1.55874 WP_000076690.1.55886 WP_000076690.1.5589 WP_000076690.1.55904 WP_000076690.1.55916 WP_000076690.1.55933 WP_000076690.1.55953 WP_000076690.1.55955 WP_000076690.1.55960 WP_000076690.1.56000 WP_000076690.1.56003 WP_000076690.1.56025 WP_000076690.1.5604 WP_000076690.1.56048 WP_000076690.1.56064 WP_000076690.1.56078 WP_000076690.1.56098 WP_000076690.1.56106 WP_000076690.1.56135 WP_000076690.1.56159 WP_000076690.1.56200 WP_000076690.1.56210 WP_000076690.1.56213 WP_000076690.1.56220 WP_000076690.1.56225 WP_000076690.1.5623 WP_000076690.1.56237 WP_000076690.1.56239 WP_000076690.1.56241 WP_000076690.1.56260 WP_000076690.1.56265 WP_000076690.1.56275 WP_000076690.1.56281 WP_000076690.1.56332 WP_000076690.1.56333 WP_000076690.1.5635 WP_000076690.1.56364 WP_000076690.1.5637 WP_000076690.1.56377 WP_000076690.1.56387 WP_000076690.1.56400 WP_000076690.1.5644 WP_000076690.1.56444 WP_000076690.1.56464 WP_000076690.1.56482 WP_000076690.1.56522 WP_000076690.1.56525 WP_000076690.1.56530 WP_000076690.1.56542 WP_000076690.1.56558 WP_000076690.1.5658 WP_000076690.1.56598 WP_000076690.1.566 WP_000076690.1.56608 WP_000076690.1.56619 WP_000076690.1.56628 WP_000076690.1.56641 WP_000076690.1.56658 WP_000076690.1.5666 WP_000076690.1.56679 WP_000076690.1.56696 WP_000076690.1.56702 WP_000076690.1.56708 WP_000076690.1.56737 WP_000076690.1.5675 WP_000076690.1.5677 WP_000076690.1.56772 WP_000076690.1.56778 WP_000076690.1.56779 WP_000076690.1.56794 WP_000076690.1.56815 WP_000076690.1.56856 WP_000076690.1.5686 WP_000076690.1.56865 WP_000076690.1.56878 WP_000076690.1.569 WP_000076690.1.56903 WP_000076690.1.56931 WP_000076690.1.56966 WP_000076690.1.56986 WP_000076690.1.57015 WP_000076690.1.57024 WP_000076690.1.5705 WP_000076690.1.57073 WP_000076690.1.57075 WP_000076690.1.57081 WP_000076690.1.57097 WP_000076690.1.57109 WP_000076690.1.57115 WP_000076690.1.57141 WP_000076690.1.57158 WP_000076690.1.57170 WP_000076690.1.5718 WP_000076690.1.57190 WP_000076690.1.57214 WP_000076690.1.57265 WP_000076690.1.57271 WP_000076690.1.57291 WP_000076690.1.57309 WP_000076690.1.57330 WP_000076690.1.5735 WP_000076690.1.57385 WP_000076690.1.57389 WP_000076690.1.57427 WP_000076690.1.57445 WP_000076690.1.57448 WP_000076690.1.57459 WP_000076690.1.57481 WP_000076690.1.57593 WP_000076690.1.57594 WP_000076690.1.57635 WP_000076690.1.57650 WP_000076690.1.57665 WP_000076690.1.57670 WP_000076690.1.57682 WP_000076690.1.57692 WP_000076690.1.57693 WP_000076690.1.57701 WP_000076690.1.57718 WP_000076690.1.57727 WP_000076690.1.57730 WP_000076690.1.57734 WP_000076690.1.57745 WP_000076690.1.57754 WP_000076690.1.57783 WP_000076690.1.57808 WP_000076690.1.57819 WP_000076690.1.57837 WP_000076690.1.57840 WP_000076690.1.57844 WP_000076690.1.57861 WP_000076690.1.57875 WP_000076690.1.57878 WP_000076690.1.5791 WP_000076690.1.57928 WP_000076690.1.57952 WP_000076690.1.57962 WP_000076690.1.57974 WP_000076690.1.5799 WP_000076690.1.58006 WP_000076690.1.58016 WP_000076690.1.58035 WP_000076690.1.58049 WP_000076690.1.58051 WP_000076690.1.58074 WP_000076690.1.58116 WP_000076690.1.58122 WP_000076690.1.58127 WP_000076690.1.58139 WP_000076690.1.58148 WP_000076690.1.58158 WP_000076690.1.5816 WP_000076690.1.5817 WP_000076690.1.58185 WP_000076690.1.58198 WP_000076690.1.58212 WP_000076690.1.58241 WP_000076690.1.58246 WP_000076690.1.5827 WP_000076690.1.58277 WP_000076690.1.58317 WP_000076690.1.58321 WP_000076690.1.58325 WP_000076690.1.58350 WP_000076690.1.58352 WP_000076690.1.58353 WP_000076690.1.58364 WP_000076690.1.58366 WP_000076690.1.58373 WP_000076690.1.58392 WP_000076690.1.58395 WP_000076690.1.58421 WP_000076690.1.58430 WP_000076690.1.58481 WP_000076690.1.5849 WP_000076690.1.58495 WP_000076690.1.58497 WP_000076690.1.58504 WP_000076690.1.58508 WP_000076690.1.58512 WP_000076690.1.58521 WP_000076690.1.58530 WP_000076690.1.5857 WP_000076690.1.58571 WP_000076690.1.58584 WP_000076690.1.58588 WP_000076690.1.58592 WP_000076690.1.58598 WP_000076690.1.586 WP_000076690.1.58704 WP_000076690.1.58714 WP_000076690.1.58735 WP_000076690.1.58760 WP_000076690.1.58763 WP_000076690.1.58772 WP_000076690.1.58775 WP_000076690.1.5880 WP_000076690.1.58833 WP_000076690.1.58934 WP_000076690.1.58936 WP_000076690.1.58960 WP_000076690.1.58981 WP_000076690.1.58998 WP_000076690.1.5901 WP_000076690.1.59011 WP_000076690.1.59014 WP_000076690.1.59039 WP_000076690.1.5904 WP_000076690.1.59046 WP_000076690.1.59062 WP_000076690.1.59077 WP_000076690.1.59124 WP_000076690.1.59133 WP_000076690.1.59146 WP_000076690.1.59157 WP_000076690.1.59178 WP_000076690.1.5920 WP_000076690.1.5925 WP_000076690.1.59269 WP_000076690.1.59284 WP_000076690.1.59311 WP_000076690.1.59327 WP_000076690.1.59334 WP_000076690.1.59363 WP_000076690.1.5938 WP_000076690.1.59380 WP_000076690.1.59397 WP_000076690.1.59398 WP_000076690.1.5940 WP_000076690.1.59404 WP_000076690.1.59414 WP_000076690.1.59457 WP_000076690.1.59459 WP_000076690.1.59462 WP_000076690.1.59464 WP_000076690.1.59467 WP_000076690.1.59478 WP_000076690.1.59498 WP_000076690.1.59540 WP_000076690.1.59546 WP_000076690.1.59547 WP_000076690.1.59598 WP_000076690.1.59603 WP_000076690.1.59609 WP_000076690.1.59629 WP_000076690.1.59663 WP_000076690.1.59668 WP_000076690.1.59669 WP_000076690.1.59671 WP_000076690.1.59697 WP_000076690.1.5972 WP_000076690.1.59787 WP_000076690.1.59803 WP_000076690.1.59819 WP_000076690.1.5982 WP_000076690.1.59822 WP_000076690.1.59864 WP_000076690.1.59874 WP_000076690.1.59881 WP_000076690.1.59886 WP_000076690.1.59907 WP_000076690.1.59915 WP_000076690.1.59921 WP_000076690.1.59945 WP_000076690.1.59977 WP_000076690.1.60006 WP_000076690.1.60022 WP_000076690.1.6006 WP_000076690.1.60086 WP_000076690.1.60101 WP_000076690.1.6011 WP_000076690.1.60118 WP_000076690.1.60123 WP_000076690.1.60147 WP_000076690.1.60149 WP_000076690.1.60156 WP_000076690.1.60157 WP_000076690.1.60158 WP_000076690.1.6017 WP_000076690.1.60181 WP_000076690.1.60227 WP_000076690.1.60251 WP_000076690.1.60259 WP_000076690.1.60280 WP_000076690.1.60302 WP_000076690.1.60307 WP_000076690.1.60339 WP_000076690.1.60345 WP_000076690.1.60353 WP_000076690.1.60355 WP_000076690.1.60360 WP_000076690.1.60368 WP_000076690.1.60434 WP_000076690.1.60462 WP_000076690.1.60492 WP_000076690.1.60515 WP_000076690.1.60547 WP_000076690.1.60551 WP_000076690.1.60585 WP_000076690.1.60594 WP_000076690.1.60595 WP_000076690.1.60636 WP_000076690.1.60641 WP_000076690.1.60690 WP_000076690.1.60696 WP_000076690.1.60719 WP_000076690.1.60730 WP_000076690.1.60734 WP_000076690.1.60742 WP_000076690.1.60750 WP_000076690.1.60751 WP_000076690.1.60758 WP_000076690.1.60759 WP_000076690.1.60765 WP_000076690.1.60778 WP_000076690.1.60787 WP_000076690.1.60813 WP_000076690.1.60820 WP_000076690.1.60845 WP_000076690.1.6085 WP_000076690.1.60859 WP_000076690.1.60869 WP_000076690.1.60888 WP_000076690.1.60898 WP_000076690.1.60912 WP_000076690.1.60917 WP_000076690.1.60923 WP_000076690.1.60939 WP_000076690.1.60948 WP_000076690.1.60965 WP_000076690.1.60981 WP_000076690.1.60991 WP_000076690.1.61013 WP_000076690.1.61023 WP_000076690.1.61026 WP_000076690.1.61029 WP_000076690.1.61030 WP_000076690.1.61031 WP_000076690.1.61082 WP_000076690.1.61107 WP_000076690.1.61115 WP_000076690.1.61119 WP_000076690.1.61139 WP_000076690.1.61152 WP_000076690.1.61153 WP_000076690.1.6118 WP_000076690.1.61188 WP_000076690.1.61189 WP_000076690.1.6119 WP_000076690.1.6123 WP_000076690.1.61257 WP_000076690.1.61263 WP_000076690.1.61271 WP_000076690.1.61286 WP_000076690.1.61289 WP_000076690.1.61313 WP_000076690.1.61316 WP_000076690.1.61318 WP_000076690.1.61324 WP_000076690.1.61339 WP_000076690.1.61346 WP_000076690.1.61353 WP_000076690.1.6136 WP_000076690.1.61375 WP_000076690.1.61393 WP_000076690.1.61408 WP_000076690.1.61421 WP_000076690.1.61430 WP_000076690.1.61439 WP_000076690.1.61440 WP_000076690.1.6149 WP_000076690.1.61547 WP_000076690.1.61555 WP_000076690.1.61585 WP_000076690.1.61591 WP_000076690.1.61597 WP_000076690.1.61615 WP_000076690.1.61639 WP_000076690.1.6166 WP_000076690.1.6168 WP_000076690.1.61705 WP_000076690.1.61709 WP_000076690.1.61713 WP_000076690.1.61749 WP_000076690.1.61776 WP_000076690.1.61784 WP_000076690.1.61800 WP_000076690.1.61802 WP_000076690.1.61838 WP_000076690.1.61843 WP_000076690.1.619 WP_000076690.1.61903 WP_000076690.1.61910 WP_000076690.1.61936 WP_000076690.1.61970 WP_000076690.1.61976 WP_000076690.1.61978 WP_000076690.1.62002 WP_000076690.1.6201 WP_000076690.1.62028 WP_000076690.1.62030 WP_000076690.1.62069 WP_000076690.1.62071 WP_000076690.1.62084 WP_000076690.1.62085 WP_000076690.1.62088 WP_000076690.1.62093 WP_000076690.1.62096 WP_000076690.1.62127 WP_000076690.1.62140 WP_000076690.1.62164 WP_000076690.1.62247 WP_000076690.1.62253 WP_000076690.1.62254 WP_000076690.1.62318 WP_000076690.1.6234 WP_000076690.1.62346 WP_000076690.1.62352 WP_000076690.1.62367 WP_000076690.1.62382 WP_000076690.1.62398 WP_000076690.1.62409 WP_000076690.1.62429 WP_000076690.1.62453 WP_000076690.1.62459 WP_000076690.1.62474 WP_000076690.1.62496 WP_000076690.1.6250 WP_000076690.1.62537 WP_000076690.1.62539 WP_000076690.1.62553 WP_000076690.1.62575 WP_000076690.1.62602 WP_000076690.1.62608 WP_000076690.1.62621 WP_000076690.1.62653 WP_000076690.1.6266 WP_000076690.1.62671 WP_000076690.1.62674 WP_000076690.1.6268 WP_000076690.1.62684 WP_000076690.1.62685 WP_000076690.1.62723 WP_000076690.1.62740 WP_000076690.1.62756 WP_000076690.1.62764 WP_000076690.1.62771 WP_000076690.1.62796 WP_000076690.1.62808 WP_000076690.1.62822 WP_000076690.1.62824 WP_000076690.1.62829 WP_000076690.1.62831 WP_000076690.1.62842 WP_000076690.1.62863 WP_000076690.1.62878 WP_000076690.1.62880 WP_000076690.1.62925 WP_000076690.1.62956 WP_000076690.1.62970 WP_000076690.1.63003 WP_000076690.1.63004 WP_000076690.1.63011 WP_000076690.1.63021 WP_000076690.1.63027 WP_000076690.1.63040 WP_000076690.1.63050 WP_000076690.1.63052 WP_000076690.1.63068 WP_000076690.1.63070 WP_000076690.1.63083 WP_000076690.1.63131 WP_000076690.1.63132 WP_000076690.1.63139 WP_000076690.1.63140 WP_000076690.1.63170 WP_000076690.1.63182 WP_000076690.1.63195 WP_000076690.1.63215 WP_000076690.1.63220 WP_000076690.1.63233 WP_000076690.1.63244 WP_000076690.1.63266 WP_000076690.1.63273 WP_000076690.1.63279 WP_000076690.1.63288 WP_000076690.1.63289 WP_000076690.1.63296 WP_000076690.1.63304 WP_000076690.1.63307 WP_000076690.1.63313 WP_000076690.1.63319 WP_000076690.1.63324 WP_000076690.1.63333 WP_000076690.1.63335 WP_000076690.1.63337 WP_000076690.1.63341 WP_000076690.1.63383 WP_000076690.1.63406 WP_000076690.1.63411 WP_000076690.1.63421 WP_000076690.1.63460 WP_000076690.1.63469 WP_000076690.1.63471 WP_000076690.1.63510 WP_000076690.1.63527 WP_000076690.1.63540 WP_000076690.1.63565 WP_000076690.1.63589 WP_000076690.1.63617 WP_000076690.1.63635 WP_000076690.1.63672 WP_000076690.1.63673 WP_000076690.1.63693 WP_000076690.1.63704 WP_000076690.1.63705 WP_000076690.1.63726 WP_000076690.1.63729 WP_000076690.1.6374 WP_000076690.1.63751 WP_000076690.1.63759 WP_000076690.1.63763 WP_000076690.1.63774 WP_000076690.1.6378 WP_000076690.1.63828 WP_000076690.1.63847 WP_000076690.1.63874 WP_000076690.1.6388 WP_000076690.1.63890 WP_000076690.1.63894 WP_000076690.1.63895 WP_000076690.1.63907 WP_000076690.1.63978 WP_000076690.1.63998 WP_000076690.1.64012 WP_000076690.1.6403 WP_000076690.1.6408 WP_000076690.1.64094 WP_000076690.1.64105 WP_000076690.1.64108 WP_000076690.1.64127 WP_000076690.1.64192 WP_000076690.1.64207 WP_000076690.1.64232 WP_000076690.1.64250 WP_000076690.1.64251 WP_000076690.1.64279 WP_000076690.1.64288 WP_000076690.1.64303 WP_000076690.1.64367 WP_000076690.1.64368 WP_000076690.1.6438 WP_000076690.1.64434 WP_000076690.1.64446 WP_000076690.1.64456 WP_000076690.1.64457 WP_000076690.1.64473 WP_000076690.1.64525 WP_000076690.1.6453 WP_000076690.1.64537 WP_000076690.1.64549 WP_000076690.1.64565 WP_000076690.1.64583 WP_000076690.1.6459 WP_000076690.1.64598 WP_000076690.1.6462 WP_000076690.1.64631 WP_000076690.1.64665 WP_000076690.1.64677 WP_000076690.1.64686 WP_000076690.1.64720 WP_000076690.1.64765 WP_000076690.1.6479 WP_000076690.1.64811 WP_000076690.1.64845 WP_000076690.1.64858 WP_000076690.1.64860 WP_000076690.1.64879 WP_000076690.1.6488 WP_000076690.1.64897 WP_000076690.1.64928 WP_000076690.1.64935 WP_000076690.1.64951 WP_000076690.1.64956 WP_000076690.1.64961 WP_000076690.1.64996 WP_000076690.1.64998 WP_000076690.1.65025 WP_000076690.1.65038 WP_000076690.1.65044 WP_000076690.1.65076 WP_000076690.1.6509 WP_000076690.1.65132 WP_000076690.1.65158 WP_000076690.1.65180 WP_000076690.1.65193 WP_000076690.1.65203 WP_000076690.1.65217 WP_000076690.1.65233 WP_000076690.1.65243 WP_000076690.1.65264 WP_000076690.1.6531 WP_000076690.1.65317 WP_000076690.1.65358 WP_000076690.1.65367 WP_000076690.1.65387 WP_000076690.1.65406 WP_000076690.1.65407 WP_000076690.1.65419 WP_000076690.1.65423 WP_000076690.1.65432 WP_000076690.1.6544 WP_000076690.1.65443 WP_000076690.1.65448 WP_000076690.1.65451 WP_000076690.1.6547 WP_000076690.1.65504 WP_000076690.1.6551 WP_000076690.1.65520 WP_000076690.1.65544 WP_000076690.1.65562 WP_000076690.1.65585 WP_000076690.1.65616 WP_000076690.1.65629 WP_000076690.1.65643 WP_000076690.1.65656 WP_000076690.1.65675 WP_000076690.1.6568 WP_000076690.1.65689 WP_000076690.1.65693 WP_000076690.1.65700 WP_000076690.1.65703 WP_000076690.1.65713 WP_000076690.1.65717 WP_000076690.1.65734 WP_000076690.1.65769 WP_000076690.1.6578 WP_000076690.1.65809 WP_000076690.1.6585 WP_000076690.1.65856 WP_000076690.1.65886 WP_000076690.1.65892 WP_000076690.1.65922 WP_000076690.1.65928 WP_000076690.1.65931 WP_000076690.1.65935 WP_000076690.1.65947 WP_000076690.1.65965 WP_000076690.1.65990 WP_000076690.1.66009 WP_000076690.1.66014 WP_000076690.1.6603 WP_000076690.1.66054 WP_000076690.1.66069 WP_000076690.1.66073 WP_000076690.1.66081 WP_000076690.1.661 WP_000076690.1.66120 WP_000076690.1.66130 WP_000076690.1.66133 WP_000076690.1.66144 WP_000076690.1.66175 WP_000076690.1.66262 WP_000076690.1.66265 WP_000076690.1.66287 WP_000076690.1.66298 WP_000076690.1.66302 WP_000076690.1.6632 WP_000076690.1.66322 WP_000076690.1.66328 WP_000076690.1.66366 WP_000076690.1.66433 WP_000076690.1.66453 WP_000076690.1.66505 WP_000076690.1.66513 WP_000076690.1.66518 WP_000076690.1.66519 WP_000076690.1.66542 WP_000076690.1.66556 WP_000076690.1.66564 WP_000076690.1.66588 WP_000076690.1.66598 WP_000076690.1.66601 WP_000076690.1.66606 WP_000076690.1.66611 WP_000076690.1.66614 WP_000076690.1.66645 WP_000076690.1.66664 WP_000076690.1.66677 WP_000076690.1.6668 WP_000076690.1.66711 WP_000076690.1.66726 WP_000076690.1.6674 WP_000076690.1.66756 WP_000076690.1.66766 WP_000076690.1.66786 WP_000076690.1.66792 WP_000076690.1.66803 WP_000076690.1.66816 WP_000076690.1.66818 WP_000076690.1.6684 WP_000076690.1.66853 WP_000076690.1.6688 WP_000076690.1.66904 WP_000076690.1.66906 WP_000076690.1.66938 WP_000076690.1.66969 WP_000076690.1.67012 WP_000076690.1.67014 WP_000076690.1.67016 WP_000076690.1.67067 WP_000076690.1.67072 WP_000076690.1.67112 WP_000076690.1.67113 WP_000076690.1.67135 WP_000076690.1.67152 WP_000076690.1.67155 WP_000076690.1.67160 WP_000076690.1.67191 WP_000076690.1.6722 WP_000076690.1.67238 WP_000076690.1.67251 WP_000076690.1.67259 WP_000076690.1.6726 WP_000076690.1.67266 WP_000076690.1.67286 WP_000076690.1.67294 WP_000076690.1.67296 WP_000076690.1.67312 WP_000076690.1.67328 WP_000076690.1.67329 WP_000076690.1.67333 WP_000076690.1.67375 WP_000076690.1.6740 WP_000076690.1.67414 WP_000076690.1.67418 WP_000076690.1.67420 WP_000076690.1.67425 WP_000076690.1.67457 WP_000076690.1.67460 WP_000076690.1.67463 WP_000076690.1.67480 WP_000076690.1.67505 WP_000076690.1.67507 WP_000076690.1.67520 WP_000076690.1.67521 WP_000076690.1.67540 WP_000076690.1.67554 WP_000076690.1.67571 WP_000076690.1.67572 WP_000076690.1.67620 WP_000076690.1.67621 WP_000076690.1.67632 WP_000076690.1.67644 WP_000076690.1.67651 WP_000076690.1.67653 WP_000076690.1.67691 WP_000076690.1.67712 WP_000076690.1.67713 WP_000076690.1.67722 WP_000076690.1.67754 WP_000076690.1.67762 WP_000076690.1.67806 WP_000076690.1.67808 WP_000076690.1.67815 WP_000076690.1.67834 WP_000076690.1.6786 WP_000076690.1.67865 WP_000076690.1.67867 WP_000076690.1.67880 WP_000076690.1.67900 WP_000076690.1.67925 WP_000076690.1.67931 WP_000076690.1.67986 WP_000076690.1.67991 WP_000076690.1.68020 WP_000076690.1.68033 WP_000076690.1.68054 WP_000076690.1.68066 WP_000076690.1.68101 WP_000076690.1.6811 WP_000076690.1.68111 WP_000076690.1.68134 WP_000076690.1.68141 WP_000076690.1.68152 WP_000076690.1.68160 WP_000076690.1.68161 WP_000076690.1.68199 WP_000076690.1.68202 WP_000076690.1.68221 WP_000076690.1.68223 WP_000076690.1.68233 WP_000076690.1.6824 WP_000076690.1.68261 WP_000076690.1.68268 WP_000076690.1.68286 WP_000076690.1.68295 WP_000076690.1.68299 WP_000076690.1.6830 WP_000076690.1.68307 WP_000076690.1.68334 WP_000076690.1.6834 WP_000076690.1.68343 WP_000076690.1.68351 WP_000076690.1.68355 WP_000076690.1.68366 WP_000076690.1.68367 WP_000076690.1.6839 WP_000076690.1.68392 WP_000076690.1.68397 WP_000076690.1.68398 WP_000076690.1.68399 WP_000076690.1.68404 WP_000076690.1.68425 WP_000076690.1.68476 WP_000076690.1.68479 WP_000076690.1.68483 WP_000076690.1.68489 WP_000076690.1.68504 WP_000076690.1.68505 WP_000076690.1.68512 WP_000076690.1.68522 WP_000076690.1.68548 WP_000076690.1.68565 WP_000076690.1.686 WP_000076690.1.68650 WP_000076690.1.68657 WP_000076690.1.68683 WP_000076690.1.68699 WP_000076690.1.68703 WP_000076690.1.68728 WP_000076690.1.68737 WP_000076690.1.68741 WP_000076690.1.68743 WP_000076690.1.68773 WP_000076690.1.68775 WP_000076690.1.68813 WP_000076690.1.68831 WP_000076690.1.68854 WP_000076690.1.68875 WP_000076690.1.68883 WP_000076690.1.68943 WP_000076690.1.68944 WP_000076690.1.68998 WP_000076690.1.69012 WP_000076690.1.69045 WP_000076690.1.69071 WP_000076690.1.69078 WP_000076690.1.69087 WP_000076690.1.69089 WP_000076690.1.69105 WP_000076690.1.69120 WP_000076690.1.6915 WP_000076690.1.69162 WP_000076690.1.6917 WP_000076690.1.69191 WP_000076690.1.69198 WP_000076690.1.69213 WP_000076690.1.69219 WP_000076690.1.69222 WP_000076690.1.69232 WP_000076690.1.69237 WP_000076690.1.69349 WP_000076690.1.69366 WP_000076690.1.69394 WP_000076690.1.69395 WP_000076690.1.69412 WP_000076690.1.69415 WP_000076690.1.69434 WP_000076690.1.69437 WP_000076690.1.69475 WP_000076690.1.69476 WP_000076690.1.69480 WP_000076690.1.69483 WP_000076690.1.69490 WP_000076690.1.695 WP_000076690.1.69520 WP_000076690.1.69546 WP_000076690.1.69552 WP_000076690.1.69563 WP_000076690.1.69598 WP_000076690.1.69639 WP_000076690.1.69679 WP_000076690.1.6968 WP_000076690.1.69683 WP_000076690.1.69721 WP_000076690.1.69724 WP_000076690.1.69734 WP_000076690.1.6980 WP_000076690.1.69820 WP_000076690.1.69823 WP_000076690.1.69830 WP_000076690.1.69842 WP_000076690.1.69877 WP_000076690.1.69878 WP_000076690.1.69882 WP_000076690.1.699 WP_000076690.1.69902 WP_000076690.1.69921 WP_000076690.1.69934 WP_000076690.1.69980 WP_000076690.1.69987 WP_000076690.1.69995 WP_000076690.1.70024 WP_000076690.1.70048 WP_000076690.1.70089 WP_000076690.1.70105 WP_000076690.1.7012 WP_000076690.1.70133 WP_000076690.1.70161 WP_000076690.1.70220 WP_000076690.1.70225 WP_000076690.1.70228 WP_000076690.1.7024 WP_000076690.1.70253 WP_000076690.1.70266 WP_000076690.1.70273 WP_000076690.1.70294 WP_000076690.1.703 WP_000076690.1.70311 WP_000076690.1.70313 WP_000076690.1.70334 WP_000076690.1.7034 WP_000076690.1.70344 WP_000076690.1.70349 WP_000076690.1.7043 WP_000076690.1.70448 WP_000076690.1.70451 WP_000076690.1.70457 WP_000076690.1.70459 WP_000076690.1.7046 WP_000076690.1.70462 WP_000076690.1.70487 WP_000076690.1.70495 WP_000076690.1.70527 WP_000076690.1.7053 WP_000076690.1.70541 WP_000076690.1.70546 WP_000076690.1.70554 WP_000076690.1.70558 WP_000076690.1.70564 WP_000076690.1.7061 WP_000076690.1.70611 WP_000076690.1.70635 WP_000076690.1.7064 WP_000076690.1.70641 WP_000076690.1.7067 WP_000076690.1.70672 WP_000076690.1.707 WP_000076690.1.70721 WP_000076690.1.7073 WP_000076690.1.70763 WP_000076690.1.70807 WP_000076690.1.70808 WP_000076690.1.70818 WP_000076690.1.70823 WP_000076690.1.70835 WP_000076690.1.70843 WP_000076690.1.70850 WP_000076690.1.70855 WP_000076690.1.70909 WP_000076690.1.70924 WP_000076690.1.70926 WP_000076690.1.70930 WP_000076690.1.70943 WP_000076690.1.70994 WP_000076690.1.710 WP_000076690.1.71016 WP_000076690.1.71027 WP_000076690.1.71043 WP_000076690.1.7105 WP_000076690.1.71058 WP_000076690.1.71059 WP_000076690.1.71073 WP_000076690.1.7109 WP_000076690.1.71130 WP_000076690.1.71196 WP_000076690.1.7120 WP_000076690.1.71208 WP_000076690.1.71231 WP_000076690.1.71236 WP_000076690.1.71266 WP_000076690.1.71267 WP_000076690.1.71280 WP_000076690.1.71295 WP_000076690.1.71298 WP_000076690.1.71301 WP_000076690.1.71313 WP_000076690.1.71325 WP_000076690.1.71345 WP_000076690.1.71359 WP_000076690.1.71404 WP_000076690.1.71410 WP_000076690.1.71428 WP_000076690.1.71438 WP_000076690.1.71463 WP_000076690.1.71467 WP_000076690.1.71475 WP_000076690.1.71483 WP_000076690.1.7150 WP_000076690.1.71519 WP_000076690.1.71529 WP_000076690.1.71541 WP_000076690.1.71543 WP_000076690.1.71572 WP_000076690.1.71575 WP_000076690.1.71596 WP_000076690.1.71602 WP_000076690.1.7161 WP_000076690.1.71662 WP_000076690.1.71676 WP_000076690.1.71715 WP_000076690.1.71735 WP_000076690.1.71737 WP_000076690.1.71739 WP_000076690.1.71741 WP_000076690.1.71780 WP_000076690.1.7179 WP_000076690.1.71828 WP_000076690.1.71836 WP_000076690.1.71861 WP_000076690.1.71863 WP_000076690.1.71877 WP_000076690.1.71892 WP_000076690.1.71899 WP_000076690.1.71910 WP_000076690.1.71925 WP_000076690.1.71978 WP_000076690.1.71981 WP_000076690.1.71989 WP_000076690.1.72002 WP_000076690.1.72018 WP_000076690.1.72026 WP_000076690.1.72067 WP_000076690.1.72085 WP_000076690.1.72148 WP_000076690.1.72169 WP_000076690.1.722 WP_000076690.1.72205 WP_000076690.1.72224 WP_000076690.1.72257 WP_000076690.1.72271 WP_000076690.1.72306 WP_000076690.1.72315 WP_000076690.1.72330 WP_000076690.1.72340 WP_000076690.1.72347 WP_000076690.1.7236 WP_000076690.1.72363 WP_000076690.1.72366 WP_000076690.1.72371 WP_000076690.1.72424 WP_000076690.1.72465 WP_000076690.1.72489 WP_000076690.1.72497 WP_000076690.1.72529 WP_000076690.1.72547 WP_000076690.1.7258 WP_000076690.1.7260 WP_000076690.1.72649 WP_000076690.1.72654 WP_000076690.1.72666 WP_000076690.1.72708 WP_000076690.1.72719 WP_000076690.1.72753 WP_000076690.1.72762 WP_000076690.1.72787 WP_000076690.1.72832 WP_000076690.1.72834 WP_000076690.1.72835 WP_000076690.1.72874 WP_000076690.1.72881 WP_000076690.1.72903 WP_000076690.1.72904 WP_000076690.1.72930 WP_000076690.1.72935 WP_000076690.1.72945 WP_000076690.1.72961 WP_000076690.1.72991 WP_000076690.1.73017 WP_000076690.1.73019 WP_000076690.1.73021 WP_000076690.1.73022 WP_000076690.1.73037 WP_000076690.1.73087 WP_000076690.1.73122 WP_000076690.1.73132 WP_000076690.1.73140 WP_000076690.1.73190 WP_000076690.1.73195 WP_000076690.1.73201 WP_000076690.1.73211 WP_000076690.1.73240 WP_000076690.1.73241 WP_000076690.1.73246 WP_000076690.1.73264 WP_000076690.1.73265 WP_000076690.1.73286 WP_000076690.1.73386 WP_000076690.1.73401 WP_000076690.1.73420 WP_000076690.1.73450 WP_000076690.1.73456 WP_000076690.1.73464 WP_000076690.1.73489 WP_000076690.1.73501 WP_000076690.1.73513 WP_000076690.1.73536 WP_000076690.1.73539 WP_000076690.1.73571 WP_000076690.1.73591 WP_000076690.1.736 WP_000076690.1.73610 WP_000076690.1.73639 WP_000076690.1.73640 WP_000076690.1.7365 WP_000076690.1.73674 WP_000076690.1.73685 WP_000076690.1.73693 WP_000076690.1.73694 WP_000076690.1.73735 WP_000076690.1.73740 WP_000076690.1.73759 WP_000076690.1.73786 WP_000076690.1.73789 WP_000076690.1.7380 WP_000076690.1.73834 WP_000076690.1.73837 WP_000076690.1.73885 WP_000076690.1.73900 WP_000076690.1.73902 WP_000076690.1.73910 WP_000076690.1.73920 WP_000076690.1.73921 WP_000076690.1.73940 WP_000076690.1.73949 WP_000076690.1.73961 WP_000076690.1.73969 WP_000076690.1.73971 WP_000076690.1.73976 WP_000076690.1.73983 WP_000076690.1.74004 WP_000076690.1.7401 WP_000076690.1.74010 WP_000076690.1.74025 WP_000076690.1.74027 WP_000076690.1.7406 WP_000076690.1.74073 WP_000076690.1.74081 WP_000076690.1.74085 WP_000076690.1.74157 WP_000076690.1.74161 WP_000076690.1.74173 WP_000076690.1.74216 WP_000076690.1.74234 WP_000076690.1.74242 WP_000076690.1.74257 WP_000076690.1.7427 WP_000076690.1.74284 WP_000076690.1.74295 WP_000076690.1.74327 WP_000076690.1.7434 WP_000076690.1.74353 WP_000076690.1.74356 WP_000076690.1.74380 WP_000076690.1.74429 WP_000076690.1.74456 WP_000076690.1.74457 WP_000076690.1.74468 WP_000076690.1.74533 WP_000076690.1.7457 WP_000076690.1.74576 WP_000076690.1.74587 WP_000076690.1.74610 WP_000076690.1.74638 WP_000076690.1.74676 WP_000076690.1.74681 WP_000076690.1.74693 WP_000076690.1.74696 WP_000076690.1.74704 WP_000076690.1.74731 WP_000076690.1.74747 WP_000076690.1.74758 WP_000076690.1.74770 WP_000076690.1.74785 WP_000076690.1.74797 WP_000076690.1.74802 WP_000076690.1.7482 WP_000076690.1.74846 WP_000076690.1.74866 WP_000076690.1.74874 WP_000076690.1.74890 WP_000076690.1.74911 WP_000076690.1.74922 WP_000076690.1.74961 WP_000076690.1.74978 WP_000076690.1.74985 WP_000076690.1.74994 WP_000076690.1.74999 WP_000076690.1.75038 WP_000076690.1.75044 WP_000076690.1.75048 WP_000076690.1.75052 WP_000076690.1.75070 WP_000076690.1.75111 WP_000076690.1.75127 WP_000076690.1.75131 WP_000076690.1.75132 WP_000076690.1.75186 WP_000076690.1.75227 WP_000076690.1.75252 WP_000076690.1.75253 WP_000076690.1.75294 WP_000076690.1.75298 WP_000076690.1.75320 WP_000076690.1.75323 WP_000076690.1.75327 WP_000076690.1.75349 WP_000076690.1.75351 WP_000076690.1.75356 WP_000076690.1.75365 WP_000076690.1.75379 WP_000076690.1.75399 WP_000076690.1.75409 WP_000076690.1.7542 WP_000076690.1.75438 WP_000076690.1.75440 WP_000076690.1.75521 WP_000076690.1.75527 WP_000076690.1.75538 WP_000076690.1.75551 WP_000076690.1.75566 WP_000076690.1.75571 WP_000076690.1.7561 WP_000076690.1.75647 WP_000076690.1.75649 WP_000076690.1.75652 WP_000076690.1.75685 WP_000076690.1.75692 WP_000076690.1.75704 WP_000076690.1.75728 WP_000076690.1.75743 WP_000076690.1.75769 WP_000076690.1.75775 WP_000076690.1.75805 WP_000076690.1.75830 WP_000076690.1.75840 WP_000076690.1.75851 WP_000076690.1.75862 WP_000076690.1.75885 WP_000076690.1.75910 WP_000076690.1.75929 WP_000076690.1.75944 WP_000076690.1.75952 WP_000076690.1.75956 WP_000076690.1.75969 WP_000076690.1.76010 WP_000076690.1.76013 WP_000076690.1.76015 WP_000076690.1.7602 WP_000076690.1.76047 WP_000076690.1.76049 WP_000076690.1.76050 WP_000076690.1.76053 WP_000076690.1.7607 WP_000076690.1.76095 WP_000076690.1.76111 WP_000076690.1.76114 WP_000076690.1.76121 WP_000076690.1.76123 WP_000076690.1.76143 WP_000076690.1.76153 WP_000076690.1.76179 WP_000076690.1.76230 WP_000076690.1.76234 WP_000076690.1.7624 WP_000076690.1.7625 WP_000076690.1.76258 WP_000076690.1.76261 WP_000076690.1.7627 WP_000076690.1.76294 WP_000076690.1.76313 WP_000076690.1.76332 WP_000076690.1.76337 WP_000076690.1.76351 WP_000076690.1.76411 WP_000076690.1.76419 WP_000076690.1.76420 WP_000076690.1.76421 WP_000076690.1.76424 WP_000076690.1.76426 WP_000076690.1.76431 WP_000076690.1.76463 WP_000076690.1.76497 WP_000076690.1.76528 WP_000076690.1.76648 WP_000076690.1.76659 WP_000076690.1.76686 WP_000076690.1.76689 WP_000076690.1.76690 WP_000076690.1.76693 WP_000076690.1.76711 WP_000076690.1.76718 WP_000076690.1.7675 WP_000076690.1.76790 WP_000076690.1.76792 WP_000076690.1.76798 WP_000076690.1.768 WP_000076690.1.76816 WP_000076690.1.76829 WP_000076690.1.76839 WP_000076690.1.76845 WP_000076690.1.76869 WP_000076690.1.76878 WP_000076690.1.76895 WP_000076690.1.76897 WP_000076690.1.76920 WP_000076690.1.76921 WP_000076690.1.76937 WP_000076690.1.7694 WP_000076690.1.76944 WP_000076690.1.76952 WP_000076690.1.76998 WP_000076690.1.77020 WP_000076690.1.77031 WP_000076690.1.77041 WP_000076690.1.77043 WP_000076690.1.77050 WP_000076690.1.77060 WP_000076690.1.77062 WP_000076690.1.77072 WP_000076690.1.77112 WP_000076690.1.77137 WP_000076690.1.77144 WP_000076690.1.77145 WP_000076690.1.77158 WP_000076690.1.77183 WP_000076690.1.77187 WP_000076690.1.77190 WP_000076690.1.77203 WP_000076690.1.77229 WP_000076690.1.77256 WP_000076690.1.77297 WP_000076690.1.77298 WP_000076690.1.77305 WP_000076690.1.77315 WP_000076690.1.77331 WP_000076690.1.77346 WP_000076690.1.77359 WP_000076690.1.77388 WP_000076690.1.77416 WP_000076690.1.77426 WP_000076690.1.7745 WP_000076690.1.7746 WP_000076690.1.77489 WP_000076690.1.77497 WP_000076690.1.77498 WP_000076690.1.77520 WP_000076690.1.77527 WP_000076690.1.77532 WP_000076690.1.77533 WP_000076690.1.77536 WP_000076690.1.77572 WP_000076690.1.77583 WP_000076690.1.77603 WP_000076690.1.77606 WP_000076690.1.77650 WP_000076690.1.77735 WP_000076690.1.77738 WP_000076690.1.7774 WP_000076690.1.77743 WP_000076690.1.77763 WP_000076690.1.77791 WP_000076690.1.77818 WP_000076690.1.77822 WP_000076690.1.77848 WP_000076690.1.7785 WP_000076690.1.77858 WP_000076690.1.7786 WP_000076690.1.77860 WP_000076690.1.7787 WP_000076690.1.77882 WP_000076690.1.77883 WP_000076690.1.77893 WP_000076690.1.77915 WP_000076690.1.77922 WP_000076690.1.77930 WP_000076690.1.77957 WP_000076690.1.77986 WP_000076690.1.78038 WP_000076690.1.78054 WP_000076690.1.78082 WP_000076690.1.78091 WP_000076690.1.78093 WP_000076690.1.78164 WP_000076690.1.78173 WP_000076690.1.78179 WP_000076690.1.78189 WP_000076690.1.78194 WP_000076690.1.78207 WP_000076690.1.78252 WP_000076690.1.78254 WP_000076690.1.78257 WP_000076690.1.7827 WP_000076690.1.78304 WP_000076690.1.78311 WP_000076690.1.78324 WP_000076690.1.78330 WP_000076690.1.78332 WP_000076690.1.78365 WP_000076690.1.78371 WP_000076690.1.78404 WP_000076690.1.78434 WP_000076690.1.78436 WP_000076690.1.78470 WP_000076690.1.78489 WP_000076690.1.78494 WP_000076690.1.7850 WP_000076690.1.78513 WP_000076690.1.7853 WP_000076690.1.7857 WP_000076690.1.78573 WP_000076690.1.78585 WP_000076690.1.78592 WP_000076690.1.78604 WP_000076690.1.78638 WP_000076690.1.78653 WP_000076690.1.78662 WP_000076690.1.78667 WP_000076690.1.78685 WP_000076690.1.78708 WP_000076690.1.78728 WP_000076690.1.78731 WP_000076690.1.78736 WP_000076690.1.78758 WP_000076690.1.78763 WP_000076690.1.78785 WP_000076690.1.78803 WP_000076690.1.78816 WP_000076690.1.78819 WP_000076690.1.78841 WP_000076690.1.78897 WP_000076690.1.78920 WP_000076690.1.78937 WP_000076690.1.78946 WP_000076690.1.78978 WP_000076690.1.78983 WP_000076690.1.78991 WP_000076690.1.78995 WP_000076690.1.7900 WP_000076690.1.79006 WP_000076690.1.79038 WP_000076690.1.7905 WP_000076690.1.79051 WP_000076690.1.79059 WP_000076690.1.79085 WP_000076690.1.79110 WP_000076690.1.79131 WP_000076690.1.7914 WP_000076690.1.79143 WP_000076690.1.79156 WP_000076690.1.79170 WP_000076690.1.79178 WP_000076690.1.79192 WP_000076690.1.79197 WP_000076690.1.79208 WP_000076690.1.79223 WP_000076690.1.79275 WP_000076690.1.7931 WP_000076690.1.79310 WP_000076690.1.79314 WP_000076690.1.79322 WP_000076690.1.79332 WP_000076690.1.79341 WP_000076690.1.79367 WP_000076690.1.79374 WP_000076690.1.79378 WP_000076690.1.79379 WP_000076690.1.79400 WP_000076690.1.79436 WP_000076690.1.79452 WP_000076690.1.79461 WP_000076690.1.79476 WP_000076690.1.79487 WP_000076690.1.79552 WP_000076690.1.79556 WP_000076690.1.79626 WP_000076690.1.79627 WP_000076690.1.79662 WP_000076690.1.79672 WP_000076690.1.79677 WP_000076690.1.79706 WP_000076690.1.79731 WP_000076690.1.79737 WP_000076690.1.79763 WP_000076690.1.7981 WP_000076690.1.79815 WP_000076690.1.79822 WP_000076690.1.79831 WP_000076690.1.79834 WP_000076690.1.79837 WP_000076690.1.79855 WP_000076690.1.7989 WP_000076690.1.79896 WP_000076690.1.79904 WP_000076690.1.79911 WP_000076690.1.7992 WP_000076690.1.79941 WP_000076690.1.79949 WP_000076690.1.79961 WP_000076690.1.79971 WP_000076690.1.79991 WP_000076690.1.80000 WP_000076690.1.80009 WP_000076690.1.80013 WP_000076690.1.80029 WP_000076690.1.80032 WP_000076690.1.80042 WP_000076690.1.80079 WP_000076690.1.80086 WP_000076690.1.80109 WP_000076690.1.80119 WP_000076690.1.80120 WP_000076690.1.80122 WP_000076690.1.80124 WP_000076690.1.80127 WP_000076690.1.80152 WP_000076690.1.80178 WP_000076690.1.80184 WP_000076690.1.80203 WP_000076690.1.80206 WP_000076690.1.80210 WP_000076690.1.80244 WP_000076690.1.80274 WP_000076690.1.80286 WP_000076690.1.80287 WP_000076690.1.80290 WP_000076690.1.8030 WP_000076690.1.8031 WP_000076690.1.80316 WP_000076690.1.80317 WP_000076690.1.8035 WP_000076690.1.80358 WP_000076690.1.80361 WP_000076690.1.80378 WP_000076690.1.80389 WP_000076690.1.80393 WP_000076690.1.8040 WP_000076690.1.80414 WP_000076690.1.8043 WP_000076690.1.80434 WP_000076690.1.8045 WP_000076690.1.80472 WP_000076690.1.80521 WP_000076690.1.80530 WP_000076690.1.80582 WP_000076690.1.80647 WP_000076690.1.8065 WP_000076690.1.80680 WP_000076690.1.80687 WP_000076690.1.80717 WP_000076690.1.80734 WP_000076690.1.80745 WP_000076690.1.80761 WP_000076690.1.80762 WP_000076690.1.80763 WP_000076690.1.8077 WP_000076690.1.80781 WP_000076690.1.80786 WP_000076690.1.80833 WP_000076690.1.8084 WP_000076690.1.80845 WP_000076690.1.80872 WP_000076690.1.80899 WP_000076690.1.809 WP_000076690.1.80962 WP_000076690.1.80972 WP_000076690.1.81022 WP_000076690.1.81049 WP_000076690.1.81052 WP_000076690.1.81055 WP_000076690.1.81064 WP_000076690.1.81065 WP_000076690.1.81085 WP_000076690.1.81095 WP_000076690.1.81114 WP_000076690.1.81132 WP_000076690.1.81151 WP_000076690.1.81157 WP_000076690.1.81171 WP_000076690.1.81172 WP_000076690.1.81176 WP_000076690.1.81184 WP_000076690.1.81214 WP_000076690.1.81228 WP_000076690.1.81232 WP_000076690.1.81234 WP_000076690.1.81243 WP_000076690.1.8125 WP_000076690.1.81252 WP_000076690.1.81288 WP_000076690.1.81344 WP_000076690.1.8135 WP_000076690.1.81379 WP_000076690.1.81385 WP_000076690.1.81387 WP_000076690.1.81389 WP_000076690.1.8142 WP_000076690.1.8144 WP_000076690.1.81464 WP_000076690.1.81467 WP_000076690.1.81508 WP_000076690.1.81574 WP_000076690.1.81599 WP_000076690.1.8160 WP_000076690.1.81604 WP_000076690.1.81610 WP_000076690.1.81619 WP_000076690.1.81645 WP_000076690.1.81718 WP_000076690.1.81738 WP_000076690.1.81740 WP_000076690.1.81758 WP_000076690.1.81789 WP_000076690.1.8180 WP_000076690.1.81800 WP_000076690.1.81810 WP_000076690.1.81812 WP_000076690.1.81829 WP_000076690.1.81831 WP_000076690.1.81838 WP_000076690.1.8185 WP_000076690.1.81861 WP_000076690.1.81897 WP_000076690.1.81903 WP_000076690.1.81905 WP_000076690.1.81906 WP_000076690.1.81919 WP_000076690.1.81944 WP_000076690.1.81955 WP_000076690.1.81969 WP_000076690.1.81982 WP_000076690.1.81990 WP_000076690.1.81999 WP_000076690.1.82009 WP_000076690.1.82017 WP_000076690.1.82053 WP_000076690.1.8206 WP_000076690.1.82091 WP_000076690.1.82103 WP_000076690.1.82121 WP_000076690.1.8213 WP_000076690.1.82174 WP_000076690.1.82184 WP_000076690.1.82219 WP_000076690.1.82234 WP_000076690.1.82247 WP_000076690.1.82253 WP_000076690.1.82259 WP_000076690.1.82281 WP_000076690.1.82301 WP_000076690.1.82315 WP_000076690.1.82340 WP_000076690.1.82349 WP_000076690.1.82354 WP_000076690.1.82358 WP_000076690.1.82368 WP_000076690.1.82406 WP_000076690.1.82441 WP_000076690.1.82447 WP_000076690.1.82455 WP_000076690.1.82458 WP_000076690.1.8246 WP_000076690.1.82467 WP_000076690.1.82468 WP_000076690.1.82525 WP_000076690.1.82535 WP_000076690.1.82548 WP_000076690.1.82558 WP_000076690.1.82612 WP_000076690.1.8265 WP_000076690.1.8266 WP_000076690.1.82664 WP_000076690.1.82678 WP_000076690.1.82709 WP_000076690.1.82724 WP_000076690.1.82768 WP_000076690.1.82775 WP_000076690.1.82796 WP_000076690.1.8280 WP_000076690.1.82802 WP_000076690.1.82824 WP_000076690.1.82829 WP_000076690.1.82855 WP_000076690.1.82862 WP_000076690.1.8288 WP_000076690.1.8289 WP_000076690.1.82930 WP_000076690.1.82941 WP_000076690.1.82976 WP_000076690.1.82980 WP_000076690.1.8302 WP_000076690.1.83021 WP_000076690.1.83046 WP_000076690.1.83054 WP_000076690.1.83078 WP_000076690.1.83086 WP_000076690.1.83088 WP_000076690.1.8310 WP_000076690.1.83103 WP_000076690.1.83152 WP_000076690.1.83153 WP_000076690.1.8318 WP_000076690.1.83185 WP_000076690.1.8319 WP_000076690.1.83193 WP_000076690.1.83203 WP_000076690.1.83234 WP_000076690.1.83249 WP_000076690.1.83250 WP_000076690.1.8328 WP_000076690.1.83291 WP_000076690.1.83316 WP_000076690.1.83352 WP_000076690.1.83359 WP_000076690.1.83372 WP_000076690.1.83405 WP_000076690.1.83417 WP_000076690.1.8346 WP_000076690.1.83467 WP_000076690.1.83468 WP_000076690.1.83472 WP_000076690.1.83476 WP_000076690.1.83479 WP_000076690.1.83484 WP_000076690.1.83517 WP_000076690.1.83520 WP_000076690.1.83553 WP_000076690.1.83593 WP_000076690.1.83597 WP_000076690.1.83646 WP_000076690.1.83653 WP_000076690.1.8366 WP_000076690.1.83674 WP_000076690.1.83676 WP_000076690.1.83720 WP_000076690.1.83728 WP_000076690.1.83750 WP_000076690.1.83756 WP_000076690.1.83758 WP_000076690.1.83763 WP_000076690.1.83769 WP_000076690.1.83788 WP_000076690.1.83792 WP_000076690.1.83797 WP_000076690.1.83804 WP_000076690.1.83825 WP_000076690.1.8383 WP_000076690.1.83844 WP_000076690.1.8385 WP_000076690.1.83864 WP_000076690.1.83865 WP_000076690.1.83881 WP_000076690.1.83886 WP_000076690.1.83912 WP_000076690.1.83919 WP_000076690.1.83928 WP_000076690.1.83955 WP_000076690.1.83984 WP_000076690.1.83989 WP_000076690.1.84010 WP_000076690.1.84025 WP_000076690.1.84049 WP_000076690.1.84054 WP_000076690.1.84129 WP_000076690.1.84144 WP_000076690.1.84163 WP_000076690.1.84188 WP_000076690.1.84194 WP_000076690.1.84275 WP_000076690.1.84293 WP_000076690.1.84342 WP_000076690.1.84414 WP_000076690.1.84415 WP_000076690.1.84418 WP_000076690.1.84442 WP_000076690.1.84445 WP_000076690.1.84451 WP_000076690.1.84509 WP_000076690.1.84563 WP_000076690.1.84578 WP_000076690.1.84590 WP_000076690.1.84596 WP_000076690.1.84608 WP_000076690.1.8462 WP_000076690.1.84625 WP_000076690.1.84638 WP_000076690.1.84648 WP_000076690.1.84651 WP_000076690.1.84673 WP_000076690.1.84679 WP_000076690.1.8468 WP_000076690.1.84682 WP_000076690.1.84696 WP_000076690.1.84714 WP_000076690.1.8475 WP_000076690.1.84752 WP_000076690.1.84757 WP_000076690.1.84761 WP_000076690.1.84815 WP_000076690.1.84826 WP_000076690.1.84844 WP_000076690.1.84847 WP_000076690.1.84854 WP_000076690.1.84889 WP_000076690.1.84903 WP_000076690.1.84907 WP_000076690.1.84922 WP_000076690.1.84924 WP_000076690.1.8493 WP_000076690.1.8496 WP_000076690.1.84975 WP_000076690.1.84978 WP_000076690.1.85017 WP_000076690.1.85022 WP_000076690.1.85026 WP_000076690.1.85045 WP_000076690.1.85047 WP_000076690.1.85056 WP_000076690.1.85070 WP_000076690.1.85081 WP_000076690.1.85099 WP_000076690.1.85113 WP_000076690.1.85132 WP_000076690.1.85133 WP_000076690.1.85135 WP_000076690.1.85144 WP_000076690.1.85151 WP_000076690.1.85213 WP_000076690.1.85226 WP_000076690.1.85229 WP_000076690.1.85235 WP_000076690.1.85238 WP_000076690.1.85289 WP_000076690.1.85331 WP_000076690.1.85351 WP_000076690.1.85354 WP_000076690.1.85374 WP_000076690.1.85375 WP_000076690.1.85376 WP_000076690.1.85383 WP_000076690.1.85395 WP_000076690.1.85401 WP_000076690.1.85404 WP_000076690.1.85409 WP_000076690.1.85425 WP_000076690.1.85440 WP_000076690.1.85441 WP_000076690.1.85445 WP_000076690.1.85462 WP_000076690.1.85471 WP_000076690.1.85474 WP_000076690.1.85485 WP_000076690.1.85492 WP_000076690.1.85506 WP_000076690.1.85515 WP_000076690.1.85519 WP_000076690.1.85547 WP_000076690.1.85549 WP_000076690.1.85562 WP_000076690.1.85585 WP_000076690.1.85586 WP_000076690.1.85634 WP_000076690.1.85649 WP_000076690.1.85730 WP_000076690.1.85732 WP_000076690.1.85758 WP_000076690.1.8576 WP_000076690.1.85795 WP_000076690.1.85796 WP_000076690.1.85816 WP_000076690.1.85834 WP_000076690.1.85858 WP_000076690.1.85873 WP_000076690.1.85906 WP_000076690.1.85924 WP_000076690.1.85927 WP_000076690.1.85980 WP_000076690.1.85993 WP_000076690.1.86018 WP_000076690.1.86036 WP_000076690.1.86042 WP_000076690.1.86072 WP_000076690.1.86086 WP_000076690.1.8609 WP_000076690.1.86123 WP_000076690.1.86136 WP_000076690.1.86144 WP_000076690.1.86154 WP_000076690.1.86158 WP_000076690.1.86188 WP_000076690.1.862 WP_000076690.1.86207 WP_000076690.1.86209 WP_000076690.1.86248 WP_000076690.1.8627 WP_000076690.1.86270 WP_000076690.1.86281 WP_000076690.1.86304 WP_000076690.1.86315 WP_000076690.1.86331 WP_000076690.1.86344 WP_000076690.1.8636 WP_000076690.1.86363 WP_000076690.1.86367 WP_000076690.1.86378 WP_000076690.1.86390 WP_000076690.1.8643 WP_000076690.1.86439 WP_000076690.1.86473 WP_000076690.1.86482 WP_000076690.1.86508 WP_000076690.1.86523 WP_000076690.1.86526 WP_000076690.1.86531 WP_000076690.1.86542 WP_000076690.1.86628 WP_000076690.1.86664 WP_000076690.1.86704 WP_000076690.1.86706 WP_000076690.1.86736 WP_000076690.1.86745 WP_000076690.1.86792 WP_000076690.1.86793 WP_000076690.1.86795 WP_000076690.1.8681 WP_000076690.1.86838 WP_000076690.1.8690 WP_000076690.1.86910 WP_000076690.1.86911 WP_000076690.1.86916 WP_000076690.1.86940 WP_000076690.1.86961 WP_000076690.1.86968 WP_000076690.1.86977 WP_000076690.1.86999 WP_000076690.1.87021 WP_000076690.1.87042 WP_000076690.1.87057 WP_000076690.1.87072 WP_000076690.1.87088 WP_000076690.1.87090 WP_000076690.1.87097 WP_000076690.1.87100 WP_000076690.1.87119 WP_000076690.1.87122 WP_000076690.1.87133 WP_000076690.1.87137 WP_000076690.1.87141 WP_000076690.1.87168 WP_000076690.1.87175 WP_000076690.1.87190 WP_000076690.1.87194 WP_000076690.1.8720 WP_000076690.1.87204 WP_000076690.1.87236 WP_000076690.1.87260 WP_000076690.1.87261 WP_000076690.1.87264 WP_000076690.1.87285 WP_000076690.1.87290 WP_000076690.1.87296 WP_000076690.1.87363 WP_000076690.1.87372 WP_000076690.1.87388 WP_000076690.1.87396 WP_000076690.1.87457 WP_000076690.1.87461 WP_000076690.1.87466 WP_000076690.1.87486 WP_000076690.1.875 WP_000076690.1.87508 WP_000076690.1.87511 WP_000076690.1.87515 WP_000076690.1.8753 WP_000076690.1.87534 WP_000076690.1.87543 WP_000076690.1.87595 WP_000076690.1.87601 WP_000076690.1.8764 WP_000076690.1.8770 WP_000076690.1.87703 WP_000076690.1.87710 WP_000076690.1.87718 WP_000076690.1.87734 WP_000076690.1.87745 WP_000076690.1.87748 WP_000076690.1.87764 WP_000076690.1.8779 WP_000076690.1.87808 WP_000076690.1.87828 WP_000076690.1.87841 WP_000076690.1.87854 WP_000076690.1.87865 WP_000076690.1.87879 WP_000076690.1.87912 WP_000076690.1.87937 WP_000076690.1.87948 WP_000076690.1.87963 WP_000076690.1.87967 WP_000076690.1.87972 WP_000076690.1.87995 WP_000076690.1.88013 WP_000076690.1.88032 WP_000076690.1.88061 WP_000076690.1.88114 WP_000076690.1.88150 WP_000076690.1.88169 WP_000076690.1.88240 WP_000076690.1.88270 WP_000076690.1.88309 WP_000076690.1.88317 WP_000076690.1.88319 WP_000076690.1.88339 WP_000076690.1.88351 WP_000076690.1.88367 WP_000076690.1.88371 WP_000076690.1.88375 WP_000076690.1.88380 WP_000076690.1.88418 WP_000076690.1.88430 WP_000076690.1.88440 WP_000076690.1.88445 WP_000076690.1.88449 WP_000076690.1.8847 WP_000076690.1.88473 WP_000076690.1.88480 WP_000076690.1.88490 WP_000076690.1.88498 WP_000076690.1.88504 WP_000076690.1.88518 WP_000076690.1.88536 WP_000076690.1.88558 WP_000076690.1.88560 WP_000076690.1.88563 WP_000076690.1.8857 WP_000076690.1.88580 WP_000076690.1.88583 WP_000076690.1.88585 WP_000076690.1.8859 WP_000076690.1.88599 WP_000076690.1.88600 WP_000076690.1.88614 WP_000076690.1.88623 WP_000076690.1.88636 WP_000076690.1.88638 WP_000076690.1.88642 WP_000076690.1.88671 WP_000076690.1.88694 WP_000076690.1.88696 WP_000076690.1.8872 WP_000076690.1.88739 WP_000076690.1.8877 WP_000076690.1.88771 WP_000076690.1.88781 WP_000076690.1.88843 WP_000076690.1.88856 WP_000076690.1.88859 WP_000076690.1.88878 WP_000076690.1.8888 WP_000076690.1.88881 WP_000076690.1.88922 WP_000076690.1.88934 WP_000076690.1.88954 WP_000076690.1.88960 WP_000076690.1.88962 WP_000076690.1.8900 WP_000076690.1.89012 WP_000076690.1.89024 WP_000076690.1.89027 WP_000076690.1.89036 WP_000076690.1.89070 WP_000076690.1.89086 WP_000076690.1.89108 WP_000076690.1.89125 WP_000076690.1.8913 WP_000076690.1.89133 WP_000076690.1.89139 WP_000076690.1.89164 WP_000076690.1.8918 WP_000076690.1.89181 WP_000076690.1.89184 WP_000076690.1.89194 WP_000076690.1.89195 WP_000076690.1.89204 WP_000076690.1.89216 WP_000076690.1.89235 WP_000076690.1.8924 WP_000076690.1.89258 WP_000076690.1.89262 WP_000076690.1.89284 WP_000076690.1.8929 WP_000076690.1.89290 WP_000076690.1.89348 WP_000076690.1.89350 WP_000076690.1.89372 WP_000076690.1.89390 WP_000076690.1.89404 WP_000076690.1.89433 WP_000076690.1.89476 WP_000076690.1.89516 WP_000076690.1.89537 WP_000076690.1.89544 WP_000076690.1.89545 WP_000076690.1.89557 WP_000076690.1.89559 WP_000076690.1.89594 WP_000076690.1.89603 WP_000076690.1.89655 WP_000076690.1.89672 WP_000076690.1.89678 WP_000076690.1.89686 WP_000076690.1.89726 WP_000076690.1.89730 WP_000076690.1.89738 WP_000076690.1.89754 WP_000076690.1.89779 WP_000076690.1.89794 WP_000076690.1.89799 WP_000076690.1.898 WP_000076690.1.89857 WP_000076690.1.89863 WP_000076690.1.89883 WP_000076690.1.89908 WP_000076690.1.89924 WP_000076690.1.89933 WP_000076690.1.89935 WP_000076690.1.89949 WP_000076690.1.89950 WP_000076690.1.89960 WP_000076690.1.90005 WP_000076690.1.90018 WP_000076690.1.90038 WP_000076690.1.90046 WP_000076690.1.90055 WP_000076690.1.90069 WP_000076690.1.90091 WP_000076690.1.90095 WP_000076690.1.90112 WP_000076690.1.90131 WP_000076690.1.90145 WP_000076690.1.90148 WP_000076690.1.90161 WP_000076690.1.90173 WP_000076690.1.90174 WP_000076690.1.90180 WP_000076690.1.90215 WP_000076690.1.90217 WP_000076690.1.9022 WP_000076690.1.90232 WP_000076690.1.90243 WP_000076690.1.90246 WP_000076690.1.90250 WP_000076690.1.90253 WP_000076690.1.90276 WP_000076690.1.9030 WP_000076690.1.90307 WP_000076690.1.90331 WP_000076690.1.90345 WP_000076690.1.90367 WP_000076690.1.90370 WP_000076690.1.90386 WP_000076690.1.90432 WP_000076690.1.90447 WP_000076690.1.90454 WP_000076690.1.90473 WP_000076690.1.90488 WP_000076690.1.90506 WP_000076690.1.90517 WP_000076690.1.90533 WP_000076690.1.90544 WP_000076690.1.90554 WP_000076690.1.90556 WP_000076690.1.90604 WP_000076690.1.90647 WP_000076690.1.90660 WP_000076690.1.90661 WP_000076690.1.90683 WP_000076690.1.90698 WP_000076690.1.90726 WP_000076690.1.90728 WP_000076690.1.90738 WP_000076690.1.90740 WP_000076690.1.90745 WP_000076690.1.90757 WP_000076690.1.9076 WP_000076690.1.90801 WP_000076690.1.90804 WP_000076690.1.90818 WP_000076690.1.90820 WP_000076690.1.90861 WP_000076690.1.90896 WP_000076690.1.90903 WP_000076690.1.9100 WP_000076690.1.91005 WP_000076690.1.91011 WP_000076690.1.91019 WP_000076690.1.91087 WP_000076690.1.91126 WP_000076690.1.9114 WP_000076690.1.91150 WP_000076690.1.91158 WP_000076690.1.91177 WP_000076690.1.912 WP_000076690.1.9122 WP_000076690.1.91233 WP_000076690.1.91246 WP_000076690.1.91252 WP_000076690.1.91258 WP_000076690.1.91279 WP_000076690.1.91280 WP_000076690.1.91287 WP_000076690.1.91297 WP_000076690.1.91300 WP_000076690.1.91332 WP_000076690.1.91346 WP_000076690.1.91357 WP_000076690.1.91364 WP_000076690.1.91365 WP_000076690.1.91371 WP_000076690.1.91382 WP_000076690.1.9140 WP_000076690.1.91420 WP_000076690.1.91427 WP_000076690.1.91447 WP_000076690.1.91486 WP_000076690.1.91487 WP_000076690.1.91500 WP_000076690.1.91525 WP_000076690.1.9153 WP_000076690.1.91530 WP_000076690.1.9155 WP_000076690.1.91559 WP_000076690.1.91573 WP_000076690.1.91581 WP_000076690.1.91586 WP_000076690.1.91587 WP_000076690.1.91611 WP_000076690.1.91634 WP_000076690.1.91639 WP_000076690.1.91660 WP_000076690.1.91670 WP_000076690.1.917 WP_000076690.1.91704 WP_000076690.1.91745 WP_000076690.1.91746 WP_000076690.1.91749 WP_000076690.1.91771 WP_000076690.1.91791 WP_000076690.1.91800 WP_000076690.1.91816 WP_000076690.1.91829 WP_000076690.1.91848 WP_000076690.1.91895 WP_000076690.1.91909 WP_000076690.1.91918 WP_000076690.1.91919 WP_000076690.1.91928 WP_000076690.1.91950 WP_000076690.1.92 WP_000076690.1.92125 WP_000076690.1.92133 WP_000076690.1.92140 WP_000076690.1.92164 WP_000076690.1.92169 WP_000076690.1.92173 WP_000076690.1.92185 WP_000076690.1.92186 WP_000076690.1.92196 WP_000076690.1.92212 WP_000076690.1.92227 WP_000076690.1.92228 WP_000076690.1.9224 WP_000076690.1.92244 WP_000076690.1.92249 WP_000076690.1.92253 WP_000076690.1.92297 WP_000076690.1.92303 WP_000076690.1.9234 WP_000076690.1.92340 WP_000076690.1.9237 WP_000076690.1.9239 WP_000076690.1.92391 WP_000076690.1.92398 WP_000076690.1.92405 WP_000076690.1.92415 WP_000076690.1.92425 WP_000076690.1.92442 WP_000076690.1.9247 WP_000076690.1.92497 WP_000076690.1.92500 WP_000076690.1.92512 WP_000076690.1.92520 WP_000076690.1.92534 WP_000076690.1.92541 WP_000076690.1.92544 WP_000076690.1.92565 WP_000076690.1.92602 WP_000076690.1.92607 WP_000076690.1.92667 WP_000076690.1.92674 WP_000076690.1.92679 WP_000076690.1.92691 WP_000076690.1.92718 WP_000076690.1.92723 WP_000076690.1.92735 WP_000076690.1.92741 WP_000076690.1.92765 WP_000076690.1.92773 WP_000076690.1.92789 WP_000076690.1.92795 WP_000076690.1.92805 WP_000076690.1.92848 WP_000076690.1.9286 WP_000076690.1.92862 WP_000076690.1.92864 WP_000076690.1.9293 WP_000076690.1.92950 WP_000076690.1.9296 WP_000076690.1.92965 WP_000076690.1.9298 WP_000076690.1.92997 WP_000076690.1.93010 WP_000076690.1.93041 WP_000076690.1.93047 WP_000076690.1.93068 WP_000076690.1.93071 WP_000076690.1.93074 WP_000076690.1.93125 WP_000076690.1.93141 WP_000076690.1.93147 WP_000076690.1.93163 WP_000076690.1.93176 WP_000076690.1.93191 WP_000076690.1.93197 WP_000076690.1.93198 WP_000076690.1.93207 WP_000076690.1.93224 WP_000076690.1.93231 WP_000076690.1.93235 WP_000076690.1.93237 WP_000076690.1.93243 WP_000076690.1.93254 WP_000076690.1.93260 WP_000076690.1.93263 WP_000076690.1.9330 WP_000076690.1.93300 WP_000076690.1.93336 WP_000076690.1.93378 WP_000076690.1.93416 WP_000076690.1.93438 WP_000076690.1.93471 WP_000076690.1.93514 WP_000076690.1.9352 WP_000076690.1.93538 WP_000076690.1.9354 WP_000076690.1.93579 WP_000076690.1.9358 WP_000076690.1.93590 WP_000076690.1.93613 WP_000076690.1.93647 WP_000076690.1.93658 WP_000076690.1.93669 WP_000076690.1.93678 WP_000076690.1.93708 WP_000076690.1.93710 WP_000076690.1.93722 WP_000076690.1.93738 WP_000076690.1.93758 WP_000076690.1.93762 WP_000076690.1.93769 WP_000076690.1.93775 WP_000076690.1.93787 WP_000076690.1.9387 WP_000076690.1.93882 WP_000076690.1.93883 WP_000076690.1.93890 WP_000076690.1.93891 WP_000076690.1.93975 WP_000076690.1.93976 WP_000076690.1.9398 WP_000076690.1.93981 WP_000076690.1.94 WP_000076690.1.94053 WP_000076690.1.94074 WP_000076690.1.94080 WP_000076690.1.94082 WP_000076690.1.94087 WP_000076690.1.94093 WP_000076690.1.94096 WP_000076690.1.94119 WP_000076690.1.94122 WP_000076690.1.94123 WP_000076690.1.94130 WP_000076690.1.94165 WP_000076690.1.94172 WP_000076690.1.94209 WP_000076690.1.94229 WP_000076690.1.94242 WP_000076690.1.94245 WP_000076690.1.94248 WP_000076690.1.94268 WP_000076690.1.94287 WP_000076690.1.94293 WP_000076690.1.94294 WP_000076690.1.9430 WP_000076690.1.94320 WP_000076690.1.94335 WP_000076690.1.94337 WP_000076690.1.94340 WP_000076690.1.94341 WP_000076690.1.9437 WP_000076690.1.94375 WP_000076690.1.94376 WP_000076690.1.94389 WP_000076690.1.94407 WP_000076690.1.94414 WP_000076690.1.94423 WP_000076690.1.94484 WP_000076690.1.94505 WP_000076690.1.94530 WP_000076690.1.94536 WP_000076690.1.9455 WP_000076690.1.94550 WP_000076690.1.94576 WP_000076690.1.94684 WP_000076690.1.94688 WP_000076690.1.947 WP_000076690.1.94719 WP_000076690.1.94733 WP_000076690.1.94741 WP_000076690.1.94789 WP_000076690.1.94825 WP_000076690.1.94838 WP_000076690.1.94844 WP_000076690.1.94845 WP_000076690.1.9485 WP_000076690.1.94857 WP_000076690.1.94866 WP_000076690.1.94969 WP_000076690.1.9497 WP_000076690.1.94980 WP_000076690.1.94989 WP_000076690.1.94999 WP_000076690.1.95023 WP_000076690.1.95029 WP_000076690.1.95033 WP_000076690.1.95038 WP_000076690.1.95077 WP_000076690.1.9510 WP_000076690.1.95120 WP_000076690.1.95156 WP_000076690.1.95193 WP_000076690.1.95263 WP_000076690.1.95294 WP_000076690.1.95327 WP_000076690.1.95342 WP_000076690.1.95361 WP_000076690.1.95372 WP_000076690.1.9538 WP_000076690.1.95386 WP_000076690.1.95442 WP_000076690.1.95476 WP_000076690.1.95494 WP_000076690.1.95512 WP_000076690.1.95519 WP_000076690.1.95522 WP_000076690.1.95535 WP_000076690.1.95537 WP_000076690.1.95552 WP_000076690.1.95560 WP_000076690.1.9557 WP_000076690.1.95571 WP_000076690.1.95581 WP_000076690.1.95603 WP_000076690.1.95631 WP_000076690.1.95639 WP_000076690.1.95681 WP_000076690.1.95683 WP_000076690.1.95699 WP_000076690.1.95704 WP_000076690.1.95713 WP_000076690.1.95714 WP_000076690.1.95737 WP_000076690.1.95760 WP_000076690.1.95780 WP_000076690.1.95804 WP_000076690.1.95806 WP_000076690.1.95832 WP_000076690.1.95877 WP_000076690.1.95885 WP_000076690.1.959 WP_000076690.1.95914 WP_000076690.1.95918 WP_000076690.1.95962 WP_000076690.1.95986 WP_000076690.1.95997 WP_000076690.1.96014 WP_000076690.1.96022 WP_000076690.1.96030 WP_000076690.1.96056 WP_000076690.1.96057 WP_000076690.1.96067 WP_000076690.1.96105 WP_000076690.1.96135 WP_000076690.1.96148 WP_000076690.1.96160 WP_000076690.1.96163 WP_000076690.1.96209 WP_000076690.1.96218 WP_000076690.1.96228 WP_000076690.1.96255 WP_000076690.1.96271 WP_000076690.1.96280 WP_000076690.1.96283 WP_000076690.1.96297 WP_000076690.1.96305 WP_000076690.1.96312 WP_000076690.1.96314 WP_000076690.1.96316 WP_000076690.1.96322 WP_000076690.1.96334 WP_000076690.1.96362 WP_000076690.1.96433 WP_000076690.1.96468 WP_000076690.1.96472 WP_000076690.1.96474 WP_000076690.1.96477 WP_000076690.1.96489 WP_000076690.1.9650 WP_000076690.1.96535 WP_000076690.1.96538 WP_000076690.1.96548 WP_000076690.1.96554 WP_000076690.1.96566 WP_000076690.1.96568 WP_000076690.1.96578 WP_000076690.1.96591 WP_000076690.1.96603 WP_000076690.1.96628 WP_000076690.1.96637 WP_000076690.1.96638 WP_000076690.1.96646 WP_000076690.1.96678 WP_000076690.1.96699 WP_000076690.1.96705 WP_000076690.1.96727 WP_000076690.1.9675 WP_000076690.1.96770 WP_000076690.1.96780 WP_000076690.1.96804 WP_000076690.1.96836 WP_000076690.1.96855 WP_000076690.1.96859 WP_000076690.1.96866 WP_000076690.1.96882 WP_000076690.1.96895 WP_000076690.1.96918 WP_000076690.1.96922 WP_000076690.1.96928 WP_000076690.1.9695 WP_000076690.1.96956 WP_000076690.1.96965 WP_000076690.1.96969 WP_000076690.1.96976 WP_000076690.1.96985 WP_000076690.1.96997 WP_000076690.1.97000 WP_000076690.1.97001 WP_000076690.1.97004 WP_000076690.1.97007 WP_000076690.1.97014 WP_000076690.1.97017 WP_000076690.1.97019 WP_000076690.1.97029 WP_000076690.1.97034 WP_000076690.1.97072 WP_000076690.1.97117 WP_000076690.1.97138 WP_000076690.1.97141 WP_000076690.1.97161 WP_000076690.1.97164 WP_000076690.1.97191 WP_000076690.1.97205 WP_000076690.1.97228 WP_000076690.1.97230 WP_000076690.1.97241 WP_000076690.1.97267 WP_000076690.1.97302 WP_000076690.1.97312 WP_000076690.1.97336 WP_000076690.1.97348 WP_000076690.1.97352 WP_000076690.1.97355 WP_000076690.1.97367 WP_000076690.1.9737 WP_000076690.1.97392 WP_000076690.1.97411 WP_000076690.1.97427 WP_000076690.1.97450 WP_000076690.1.97456 WP_000076690.1.97460 WP_000076690.1.97494 WP_000076690.1.97530 WP_000076690.1.97531 WP_000076690.1.97536 WP_000076690.1.97537 WP_000076690.1.97574 WP_000076690.1.97576 WP_000076690.1.97585 WP_000076690.1.97590 WP_000076690.1.97627 WP_000076690.1.97664 WP_000076690.1.97687 WP_000076690.1.97696 WP_000076690.1.97699 WP_000076690.1.97720 WP_000076690.1.97731 WP_000076690.1.97739 WP_000076690.1.97742 WP_000076690.1.97744 WP_000076690.1.97746 WP_000076690.1.97758 WP_000076690.1.97762 WP_000076690.1.97763 WP_000076690.1.97786 WP_000076690.1.97827 WP_000076690.1.97835 WP_000076690.1.9788 WP_000076690.1.9789 WP_000076690.1.97899 WP_000076690.1.97928 WP_000076690.1.97935 WP_000076690.1.97955 WP_000076690.1.97974 WP_000076690.1.97997 WP_000076690.1.98011 WP_000076690.1.98033 WP_000076690.1.98051 WP_000076690.1.98058 WP_000076690.1.98073 WP_000076690.1.98161 WP_000076690.1.98174 WP_000076690.1.98179 WP_000076690.1.98195 WP_000076690.1.98233 WP_000076690.1.98242 WP_000076690.1.98248 WP_000076690.1.98249 WP_000076690.1.98295 WP_000076690.1.98307 WP_000076690.1.98328 WP_000076690.1.98353 WP_000076690.1.98360 WP_000076690.1.98361 WP_000076690.1.98366 WP_000076690.1.98387 WP_000076690.1.98409 WP_000076690.1.98411 WP_000076690.1.98425 WP_000076690.1.98456 WP_000076690.1.98512 WP_000076690.1.98548 WP_000076690.1.98552 WP_000076690.1.98559 WP_000076690.1.98585 WP_000076690.1.986 WP_000076690.1.98609 WP_000076690.1.98655 WP_000076690.1.98659 WP_000076690.1.98667 WP_000076690.1.98706 WP_000076690.1.98710 WP_000076690.1.9872 WP_000076690.1.98723 WP_000076690.1.98730 WP_000076690.1.98734 WP_000076690.1.98741 WP_000076690.1.98767 WP_000076690.1.98786 WP_000076690.1.98797 WP_000076690.1.98805 WP_000076690.1.98807 WP_000076690.1.98821 WP_000076690.1.98837 WP_000076690.1.98842 WP_000076690.1.98858 WP_000076690.1.98874 WP_000076690.1.98880 WP_000076690.1.98883 WP_000076690.1.98894 WP_000076690.1.98912 WP_000076690.1.98967 WP_000076690.1.98978 WP_000076690.1.98981 WP_000076690.1.98985 WP_000076690.1.99009 WP_000076690.1.99025 WP_000076690.1.99027 WP_000076690.1.99081 WP_000076690.1.991 WP_000076690.1.9910 WP_000076690.1.99136 WP_000076690.1.99155 WP_000076690.1.99171 WP_000076690.1.99174 WP_000076690.1.99207 WP_000076690.1.99228 WP_000076690.1.99249 WP_000076690.1.99280 WP_000076690.1.99283 WP_000076690.1.99308 WP_000076690.1.99331 WP_000076690.1.99359 WP_000076690.1.9936 WP_000076690.1.99405 WP_000076690.1.99414 WP_000076690.1.99418 WP_000076690.1.99459 WP_000076690.1.99492 WP_000076690.1.99494 WP_000076690.1.99509 WP_000076690.1.99519 WP_000076690.1.99523 WP_000076690.1.99536 WP_000076690.1.99538 WP_000076690.1.99564 WP_000076690.1.99569 WP_000076690.1.9960 WP_000076690.1.99631 WP_000076690.1.99638 WP_000076690.1.9965 WP_000076690.1.99683 WP_000076690.1.99686 WP_000076690.1.99700 WP_000076690.1.99759 WP_000076690.1.99802 WP_000076690.1.99830 WP_000076690.1.99849 WP_000076690.1.99850 WP_000076690.1.99859 WP_000076690.1.99860 WP_000076690.1.9987 WP_000076690.1.99884 WP_000076690.1.99888 WP_000076690.1.99901 WP_000076690.1.99926 WP_000076690.1.99934 WP_000076690.1.99954 WP_000076690.1.99955 WP_000076690.1.99956 WP_000076690.1.99979 WP_000076690.1.99984 WP_000076690.1.99985 WP_000076690.1.99999 YP_499784.1.76163 gi|156979595|ref|YP_001441854.1| gi|470199069|ref|YP_007585469.1| gi|514066130|ref|YP_008128050.1| gi|88194984|ref|YP_499784.1| gi|15924264|ref|NP_371798.1| gi|379014465|ref|YP_005290701.1| gi|470197102|ref|YP_007583503.1| gi|470222660|ref|YP_007621217.1| gi|385781502|ref|YP_005757673.1| gi|470193172|ref|YP_007579525.1| gi|386728960|ref|YP_006195343.1| gi|537460950|ref|YP_008491390.1| gi|545634688|ref|YP_008585258.1| gi|387780382|ref|YP_005755180.1| gi|150393823|ref|YP_001316498.1| gi|87160870|ref|YP_493864.1| gi|470195136|ref|YP_007581488.1| 158878.SAV1274 158879.SA1117 359786.SaurJH9_1334 359787.SaurJH1_1360 418127.SAHV_1264 426430.NWMN_1183 451515.SAUSA300_1167 451516.USA300HOU_1206 681288.SAAV_1249 93061.SAOUHSC_01251 93062.SACOL1293 gi|148267764|ref|YP_001246707.1| gi|384861868|ref|YP_005744588.1| gi|479329188|ref|YP_007868247.1| gi|15926857|ref|NP_374390.1| gi|269202891|ref|YP_003282160.1| gi|384869809|ref|YP_005752523.1| gi|161509440|ref|YP_001575099.1| gi|384864501|ref|YP_005749860.1| gi|470191206|ref|YP_007577516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]