SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 426430.NWMN_2144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426430.NWMN_2144
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 6.59e-23
Family Ribosomal protein L29 (L29p) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 426430.NWMN_2144
Sequence length 73
Comment (Staphylococcus aureus Newman)
Sequence
MVKQMKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTV
AREREIEQSKANQ
Download sequence
Identical sequences A0A0E0VT73 A0A0H2XHC7 A0A0H3KED7 T1YCY8
gi|386729948|ref|YP_006196331.1| gi|21283890|ref|NP_646978.1| 5ngm_AW gi|151222356|ref|YP_001333178.1| gi|537461952|ref|YP_008492392.1| gi|87161481|ref|YP_494831.1| gi|521213003|ref|YP_008169349.1| 196620.MW2161 426430.NWMN_2144 451515.SAUSA300_2196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]