SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 428406.Rpic12D_4960 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  428406.Rpic12D_4960
Domain Number 1 Region: 111-276
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.85e-56
Family NadC C-terminal domain-like 0.00000249
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 6.47e-29
Family NadC N-terminal domain-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 428406.Rpic12D_4960
Sequence length 281
Comment (Ralstonia pickettii 12D)
Sequence
MDVATRAAMTRNVCDALAEDVGNIDWTSQLVDPAASAEAVLTVREAALLCGRPWFEETLR
RYEPGITIRWFVGEGEWMREGQAVCQIAGPARSILTAERTALNFIQLLSGVATATHALVE
IVKGTRARILDTRKTLPGLRLAQKYAVRIGGGENHRRGLYDGILIKENHVAAGGGIAPTV
RAAQVIGAGVPVQVEVETLDELAQALSADAGAILLDNFSLEQMREAVRINNGRASLEVSG
GVTKETLRAIAETGVDRISVGGLTKHVRAVDFSLRVEALGA
Download sequence
Identical sequences C6BEP0 R0CDP9 U3G9H2
WP_004637196.1.50667 WP_004637196.1.63793 WP_004637196.1.7259 WP_004637196.1.7297 WP_004637196.1.93783 gi|241589823|ref|YP_002979848.1|NC_012855 gi|241589823|ref|YP_002979848.1| gi|241664364|ref|YP_002982724.1| 428406.Rpic12D_2781 428406.Rpic12D_4960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]