SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 429009.Adeg_1475 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  429009.Adeg_1475
Domain Number 1 Region: 307-462
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.48e-32
Family HD domain 0.013
Further Details:      
 
Domain Number 2 Region: 200-296
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 429009.Adeg_1475
Sequence length 512
Comment (Ammonifex degensii KC4)
Sequence
MPDTAWWIYWASLPLAFAGGYAVRRFVAEAKVRSAEERAREIIAAAEKEAEAKKKEKLLE
AKEEALRLKHELEREHRERRHELQRLERRLLQKTEAVEAKLESLSRREESLGRKEAELEA
RLKELEQLKNLRLAEIERVAQLSLEEARQLLLSEVEKEMQQEVAQLIRDMENRAKEEGER
RARMIIALAIQRCAVDQVGETTVSVVPLPNEEMKGRIIGREGRNIRAFETLTGVDLIIDD
TPEAVILSSFDPIRREIARVALEKLVADGRIHPARIEEMVEKARREVERQIWEAGEQAVL
QAGIHHIHEELIKLLGRLKFRTSYGQNVLQHSLEVMHLAGVMAAELGANVALAKRAGLLH
DIGKAVDREMEGPHVAIGVELARKYGEDPEVIHAIAAHHGDEEPQTVEAVLVQAADAISA
ARPGARRETLEAYIKRLTKLEEIAASFPGVEKAYAVQAGREIRVMVKPERVDDAATVRLA
REIAKRIESELEYPGQVKVVVIRETRAVEYAK
Download sequence
Identical sequences C9R8E2
gi|260893324|ref|YP_003239421.1| 429009.Adeg_1475 WP_015739448.1.101502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]