SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 429572.LS215_1500 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  429572.LS215_1500
Domain Number 1 Region: 65-155
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.51e-21
Family Cold shock DNA-binding domain-like 0.00000873
Further Details:      
 
Domain Number 2 Region: 6-63
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0000000000000309
Family ECR1 N-terminal domain-like 0.0000597
Further Details:      
 
Domain Number 3 Region: 151-232
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000885
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 429572.LS215_1500
Sequence length 247
Comment (Sulfolobus islandicus L S 2 15)
Sequence
MSQSQKIVLQPRSIVVPGELLAEGEFQIPWSPYILKVNSKYYSTVVGLFDVKDTQFEVIP
LEGSFYYPKVNDVVIGLVEDVEIYGWVVDIKSPYKAYLPASNLLGRSVNVGEDLRRYLDV
GDYVIARIENFDRSIDPVLSVKGKDLGRVNNGIVIDIMPVKVPRVIGKNKSMYETLTSKS
GCSMFVANNGRIWATCPSRFSEEILIEAIRKIENESHIKGLTDRIKQFIEEKLGERNASS
GETKTNP
Download sequence
Identical sequences C3MQ45 C3MVG3 C3N5R2 C3NEC8 C3NHC4 C4KHE1 D2PC56
419942.YN1551_1443 426118.M164_1399 427317.M1425_1405 427318.M1627_1455 429572.LS215_1500 439386.YG5714_1400 gi|238619847|ref|YP_002914673.1| gi|229582057|ref|YP_002840456.1| WP_012711403.1.100559 WP_012711403.1.13477 WP_012711403.1.27461 WP_012711403.1.34992 WP_012711403.1.44962 WP_012711403.1.47130 WP_012711403.1.48461 WP_012711403.1.52267 WP_012711403.1.60638 WP_012711403.1.66823 WP_012711403.1.68242 WP_012711403.1.74483 WP_012711403.1.83431 WP_012711403.1.84481 WP_012711403.1.89621 WP_012711403.1.90709 WP_012711403.1.97021 gi|284997879|ref|YP_003419646.1| gi|229579191|ref|YP_002837589.1| gi|227827676|ref|YP_002829456.1| gi|227830373|ref|YP_002832153.1| gi|229584880|ref|YP_002843382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]