SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 431943.CKL_2477 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  431943.CKL_2477
Domain Number - Region: 43-89
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000326
Family Carboxypeptidase regulatory domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 431943.CKL_2477
Sequence length 108
Comment (Clostridium kluyveri DSM 555)
Sequence
MANGKNTIELCEKRSILINTDNLNHCSKYNLNVILKCHKRVIVNGTVYNSNKIPSIGAAI
EVIQVNCDSNVKKIIGYAYTNNRGEYLFCVEVLSDIFYEMNIYSPLNM
Download sequence
Identical sequences A5N043
WP_012102823.1.77168 WP_012102823.1.89246 gi|153955095|ref|YP_001395860.1| 431943.CKL_2477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]