SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 431943.CKL_3006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  431943.CKL_3006
Domain Number 1 Region: 29-121
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000497
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 431943.CKL_3006
Sequence length 144
Comment (Clostridium kluyveri DSM 555)
Sequence
MKSRLSLILNTIKKKMGAALLCAAFAATIGTGTVLASNSTNSLLCKVVNGIKSYSTDGGK
TWSGKAPEGVNINEAKDGTGGNLEDLSLGGINGESLAVKVENGVRSYSTDGGKTWSKEVP
KGVTVSEDGKKIKVVKTQSATDAN
Download sequence
Identical sequences A5N1L8 B9E5D2
431943.CKL_3006 583346.CKR_2656 WP_012103349.1.77168 WP_012103349.1.89246 gi|153955620|ref|YP_001396385.1| gi|219855999|ref|YP_002473121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]