SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 434271.APJL_0385 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  434271.APJL_0385
Domain Number 1 Region: 57-142
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 1.44e-22
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.00016
Further Details:      
 
Domain Number 2 Region: 143-197
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 1.05e-17
Family Head domain of nucleotide exchange factor GrpE 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 434271.APJL_0385
Sequence length 198
Comment (Actinobacillus pleuropneumoniae serovar 3 JL03)
Sequence
MTAQNENAQAQAEQVEVANEAQLEQTAEVQQEQPVEAELAAAYARINELETYIAEADNRE
KDIQLRAQAEIQNIRRRAEQDVEKAHKFALEKFSKELLTVVDNLERGLNALDTAVTDEKT
QALVDGVEMTHKEFISTLAKFGVEAVGVVGEAFNPEVHEAISMQPAEGIEANHISVVLQK
GYTLQGRVLRPAMVMVAG
Download sequence
Identical sequences A0A223MFM3 B0BTB9 D9P9M3 E0E6I9 E0EWE0 E0F8U4
WP_005596364.1.11895 WP_005596364.1.6152 WP_005596364.1.71524 WP_005596364.1.74087 WP_005596364.1.77895 WP_005596364.1.86019 gi|165975827|ref|YP_001651420.1| 434271.APJL_0385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]