SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 434271.APJL_0570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  434271.APJL_0570
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-49
Family Ribonuclease PH domain 1-like 0.0000126
Further Details:      
 
Domain Number 2 Region: 297-467
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-46
Family Ribonuclease PH domain 1-like 0.0000138
Further Details:      
 
Domain Number 3 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.42e-30
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 
Domain Number 4 Region: 449-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.38e-28
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 5 Region: 607-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-21
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 
Domain Number 6 Region: 238-319
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.49e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0024
Further Details:      
 
Domain Number 7 Region: 551-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.8e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 434271.APJL_0570
Sequence length 715
Comment (Actinobacillus pleuropneumoniae serovar 3 JL03)
Sequence
MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVTVVAKKEVKEGQDFFPLTV
DYQERTYAAGRIPGGFFKREGRPSEGETLIARLIDRPVRPLFPEGFFNEIQVIATVVSVN
PQISPDLVAMIGASAALSLSGVPFNGPIGAARVGFINDQFVLNPTTSEQKISRLDLVVAG
TDKAVLMVESEADILSEEQMLSAVVFGHQQQQVVIENIKEFVKEAGKPRWDWVAPEPNTA
LINQVKALAEARIGDAYRITEKQARYEQIDAIKADVIAQLTTQDETISEGAIIDIITALE
SSIVRGRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSAIFTRGETQALAVATLGTERD
AQIIDELTGEKSDRFLFHYNFPPYSVGETGRIGSPKRREIGHGRLAKRGVLAVMPTAEEF
PYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEEEKFVVLSDI
LGDEDHLGDMDFKVAGTREGVTALQMDIKIEGITPEIMQIALNQAKGARMHILSVMEQAI
PAPRADISDFAPRIHTMKIDPKKIKDVIGKGGAVIRALTEETGTSIDIDDDGTVKIAATD
NNAAKAVMARIEDIVAEVEVNAIYKGKVTRVVDFGAFVSILGGKEGLVHISQITNERVER
VADYLSVGQEVTVKVVEIDRQNRIRLTMKDLNNDTPVAENVTEEAEVSSEQQAEI
Download sequence
Identical sequences B0BUD5
WP_012262862.1.74087 434271.APJL_0570 gi|165975991|ref|YP_001651584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]