SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 434922.CBUD_0347 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  434922.CBUD_0347
Domain Number - Region: 63-103
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0628
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 434922.CBUD_0347
Sequence length 164
Comment (Coxiella burnetii Dugway 7E9-12)
Sequence
MKNPVMILLESSPMGFKNTVKKGFFSGLNPMRWVGYEHIASNAKTIRNIVDNIIEKPTAA
SSQKETFEECLRRFNLTEEDIKKRMKNALRIVIFCLALSFGMAGYTVYLFVHGLPLSAFV
CVILTFVLWAYAFREHFNYFQMKQRRLGCTFKEWFTCTFKGSKQ
Download sequence
Identical sequences A0A2K2DXD3 A9KDJ7 Q83B66
gi|212219349|ref|YP_002306136.1| NP_820631.2.72601 WP_010958350.1.11896 WP_010958350.1.15899 WP_010958350.1.18645 WP_010958350.1.20088 WP_010958350.1.25364 WP_010958350.1.29693 WP_010958350.1.35092 WP_010958350.1.39746 WP_010958350.1.43615 WP_010958350.1.44545 WP_010958350.1.460 WP_010958350.1.513 WP_010958350.1.53098 WP_010958350.1.55037 WP_010958350.1.55635 WP_010958350.1.56161 WP_010958350.1.57074 WP_010958350.1.68745 WP_010958350.1.68840 WP_010958350.1.7296 WP_010958350.1.73073 WP_010958350.1.74283 WP_010958350.1.85884 WP_010958350.1.88235 WP_010958350.1.8942 WP_010958350.1.92481 WP_010958350.1.96664 WP_010958350.1.99156 gi|215919221|ref|NP_820631.2| 227377.CBU_1649 434922.CBUD_0347 434924.CbuK_1875 gi|209363766|ref|YP_001423770.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]