SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 434922.CBUD_0653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  434922.CBUD_0653
Domain Number 1 Region: 14-249
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.12e-67
Family Glycerophosphoryl diester phosphodiesterase 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 434922.CBUD_0653
Sequence length 250
Comment (Coxiella burnetii Dugway 7E9-12)
Sequence
MPLHIKMKTNQLNLPKVIAHRGASLSAPENTVAALREAKRLGARWVEFDVRLTRDGQAII
FHDPWLGRTTNGRGMVSKAHYAHIAELDAGNWFNPQFANERVPTFAEYLKEAASLNLGVN
IELKATPFHASDLAKQVFQELKEHWPVWLPKPLISSFSLACLRAMREQSDDCLLGYLPNR
WRDNWEALLAANQCVSIHLNYKQLTAERIKMIKQTSYYLLAYTVNDSQLATDLLSQGVDA
VVSDNPELLK
Download sequence
Identical sequences A9KC61
434922.CBUD_0653 gi|209363856|ref|YP_001424059.2| WP_011996673.1.29693 WP_011996673.1.43615 WP_011996673.1.99156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]